所有Java包所属的group列表:
com.sun.jini
org.hamcrest
junit
org.scala-lang
net.jini
net.databinder
org.slf4j
org.apache.maven
org.apache.geronimo.specs
javax.servlet
org.codehaus.plexus
org.springframework
org.osgi
net.liftweb
org.eclipse.core
org.webjars
org.scala-tools.testing
log4j
net.liftmodules
org.specs2
de.sciss
org.apache.tuscany.sca
org.scalatest
org.jvnet.hudson.plugins
org.kie.modules
com.twitter
commons-logging
org.apache.servicemix.bundles
org.ow2.jonas
org.apache.felix
org.scalaz
org.mockito
org.mortbay.jetty
org.easymock
org.xwiki.platform
org.testng
org.apache.camel
org.jboss.forge
com.typesafe.akka
org.codehaus.fabric3
commons-io
org.tinygroup
org.eclipse
org.scalatra
org.ow2.util
org.drools
commons-lang
org.apache.httpcomponents
org.apache.clerezza
org.apache.openejb
org.mobicents.resources
com.google.guava
org.jboss.as
org.wicketstuff
org.eclipse.jetty
org.apache.cxf
ch.qos.logback
org.hudsonci.plugins
org.hibernate
org.codehaus.jackson
org.apache.commons
org.apache.geronimo.modules
org.jvnet.ogc
asm
joda-time
org.apache.james
org.codehaus.mojo
com.github.philcali
org.apache.stanbol
org.kie.guvnor
org.glassfish.hk2
org.ow2.spec.ee
com.sun.enterprise
cglib
commons-codec
org.objenesis
org.ow2.frascati
javax.mail
org.apache.sling
org.jibx.schema.org.opentravel._2012A
org.json4s
org.quickgeo
org.jibx.schema.org.opentravel._2011B
org.apache.ant
org.codehaus.service-conduit
com.sun.xml.bind
org.glassfish.main.common
org.jmock
nl.cloudfarming.client
org.jibx.schema.org.opentravel._2012B
org.wildfly
org.eclipse.emf
com.google.code.findbugs
org.jbpm
org.rhq
nz.ac.waikato.cms.weka
org.objectweb.fractal.julia
org.objectweb.fractal
com.sun.grizzly
com.github.widebase
org.opencms.modules
com.google.android
org.objectweb.joram
com.google.gwt
org.glassfish
org.jclouds
maven
org.apache.directory.server
org.jvnet.hudson.main
javax.enterprise
com.wordnik
org.ow2.easybeans
org.jibx
org.clapper
org.glassfish.common
com.atlassian.confluence.plugins
org.apache.lucene
org.geomajas.plugin
net.databinder.dispatch
sk.seges.corpis
org.jboss.arquillian.extension
org.ow2.bundles
org.joda
org.codehaus.groovy
org.easytesting
org.nuxeo.ecm.platform
org.uberfire
org.apache.geronimo.framework
it.tidalwave.thesefoolishthings
org.jboss.forge.addon
net.nan21.dnet
org.sonatype.nexus
org.ow2.petals
org.ow2.petals.dsb
org.ops4j.pax.exam
org.opencms
it.tidalwave.netbeans
org.apache.uima
org.apache.marmotta
org.milyn.edi.unedifact
org.mongodb
oro
org.codehaus.sonar
javax.inject
org.graniteds
org.scalacheck
org.apache.axis2
org.apache.tomcat
it.tidalwave.bluebill
commons-collections
geronimo
org.eclipse.equinox
org.jvnet.jaxb2_commons
com.atlassian.jira
org.kuali.rice
tomcat
org.apache.ace
org.fusesource.scalate
org.objectweb.jonas
xml-apis
org.jbundle
sk.seges.sesam
org.apache.activemq
org.mobicents.examples
org.nakedobjects
org.jboss.arquillian.container
org.jboss.errai
xerces
com.google.inject
ant
org.apache.xmlgraphics
org.apache.hadoop
com.github.livesense
commons-httpclient
jboss
org.netbeans.modules
org.ow2.jasmine
org.grails
org.apache.cocoon
com.github.seratch
org.antlr
com.atlassian.translations
org.mobicents.media
org.jboss.logging
org.codehaus.woodstox
com.kenai.nbpwr
de.tudarmstadt.ukp.dkpro.core
org.jbundle.model
com.madgag
org.apache.directory.studio
org.apache.maven.shared
com.tourapp.model
com.tourgeek.model
org.apache.derby
org.mobicents.servers.diameter.resources
plexus
org.ow2.cmi
org.apache.servicemix
org.terracotta.modules
org.apache.archiva
fr.velossity.osgi
org.netbeans.api
org.sonatype.nexus.plugins
org.glassfish.external
org.codehaus.plexus.redback
org.objectweb.fractal.juliac
org.jboss
com.atlassian.upm
net.sourceforge.owlapi
org.eclipse.birt.runtime.3_7_1
com.atlassian.crowd
org.infinispan
net.sf.staccatocommons
org.apache.maven.plugins
org.sonatype.sisu
me.lessis
io.fabric8
net.stickycode.composite
org.dishevelled
org.codehaus.sonar-plugins
org.codehaus.cargo
com.atlassian.plugins
org.codehaus.plexus.security
org.scalamock
org.jibx.schema.org.opentravel._2010B
org.jibx.schema.org.opentravel._2011A
org.apache.portals.jetspeed-2
edu.washington.cs.knowitall.nlptools
org.littleshoot
org.jvnet.hudson
org.codehaus.redback
org.modeshape
commons-beanutils
org.jboss.resteasy
org.apache.xbean
stax
com.google.api.client
org.apache.stratos
org.apache.wicket
avalon-framework
xpp3
org.clojure
cocoon
com.nativelibs4java
com.sun.jersey
org.zeroturnaround
sk.seges.acris
org.ow2.bonita
org.eclipse.ui
org.sonatype.tycho
org.jclouds.provider
org.powermock
org.openrdf.sesame
org.deephacks.tools4j
org.jibx.ota.osgi
org.apache.geronimo.gshell.support
exo
com.google.apis
logkit
org.mule.modules
org.atmosphere
org.apache.tapestry
org.apache.directory.shared
org.apache.airavata
org.xwiki.commons
com.cedarsoft.commons
de.huxhorn.lilith
org.scalanlp
org.ow2.frascati.tinfi
org.jenkins-ci.plugins
org.seleniumhq.selenium
com.hack23.cia
org.glassfish.grizzly
org.apache.maven.wagon
org.ow2.jasmine.monitoring
org.apache.maven.doxia
com.typesafe
net.sourceforge.jadex
com.tourgeek.tour
com.tourapp.tour
org.dspace
org.codehaus.enunciate
org.ikasan
org.eclipse.persistence
org.apache.servicemix.tooling
org.apache.maven.mercury
org.apache.jackrabbit
com.google.dexmaker
com.googlecode.jinahya
com.foursquare
org.springframework.boot
org.mod4j.org.eclipse.equinox
org.ow2.easybeans.osgi
org.apache.struts
com.github.xuwei-k
org.eclipse.tycho
org.aperteworkflow
org.springframework.security
org.jboss.jbossas
com.revolsys.open
org.microemu
org.sakaiproject.kernel
org.kie
org.eclipse.birt.runtime
com.thoughtworks.xstream
net.sf.m-m-m
javax.xml.bind
uk.org.retep.xmpp.protocol
com.barrybecker4
net.java.dev.jna
org.picketlink
org.apache.isis.core
net.wetheinter
com.github.scala-incubator.io
org.apache.geronimo.ext.openejb
commons-jelly
javax.xml.stream
org.apache.mina
org.mod4j.org.eclipse.core
com.googlecode.jannocessor
org.ops4j.base
org.dasein
org.glassfish.main.admin
org.keycloak
org.sonatype.aether
org.apache.jclouds.provider
org.jboss.ws
commons-cli
org.objectweb.fractal.fractaladl
org.geomajas
com.yammer.metrics
com.proofpoint.platform
eu.agrosense.client
org.jboss.ejb3
org.apache.geronimo
org.datanucleus
org.json
org.ow2.fractal.juliac
org.jclouds.labs
org.ow2.frascati.examples
batik
li.rudin.mavenjs
org.apache.servicemix.examples
geronimo-spec
org.bitbucket.bradleysmithllc.etlunit
com.legsem.legstar
net.sourceforge.openutils
fr.opensagres.xdocreport
org.objectweb.monolog
org.xwiki.rendering
org.glassfish.admingui
com.ning
net.stickycode
org.fusesource.fabric
com.linkedin.pegasus
org.apache.jclouds.labs
org.neo4j
com.nesscomputing.components
xdoclet
org.eclipse.mylyn.wikitext
org.fcrepo
org.eclipse.hudson.main
org.sonatype.sisu.inject
org.jclouds.api
org.mule.transports
org.switchyard.components
it.tidalwave.northernwind
dom4j
org.apache.servicemix.specs
org.ow2.jonas.autostart
org.glassfish.fighterfish
org.apache.ws.commons.axiom
org.hobsoft.symmetry
org.juzu
org.ocpsoft.rewrite
org.codehaus.xfire
com.novocode
jaxen
com.gilt
io.cloudsoft.jclouds.provider
org.switchyard
org.apache.continuum
com.google.appengine
io.netty
com.jcraft
net.sf.ehcache
org.apache.abdera
org.scala-lang.modules
org.restlet.jse
org.openl.rules
io.airlift
com.fasterxml.jackson.core
org.apache.maven.continuum
org.jdom
com.atlassian.bamboo
org.robokind
com.h2database
org.atteo.moonshine
org.exoplatform.portal
hsqldb
org.mobicents.servlet.sip
org.apache.isis.viewer
xmlunit
org.glassfish.gmbal
mule
org.switchyard.quickstarts
net.anotheria
com.wu-man
org.cogchar
org.apache.maven.scm
org.jclouds.driver
com.google.code.gson
org.milyn
net.sf.squirrel-sql.plugins
fr.inria.powerapi
org.glassfish.metro
org.sonatype.spice
org.glassfish.main.admingui
com.googlecode.jaitools
de.fosd.typechef
org.jibx.schema.org.hr_xml.ns
org.tinygroup.annotation.0.0.12.tinygroup
org.apache.qpid
io.brooklyn
org.kantega.jexmec
org.jboss.errai.io.netty
it.tidalwave.geo
javax.persistence
org.typelevel
org.apache.solr
org.openwms
activemq
org.mobicents.servers.jainslee.core
com.atlassian.stash
com.betfair.cougar
com.github.sebhoss.contract
li.rudin.core
org.cloudhoist
com.isotrol.impe3
xml-resolver
xalan
org.springframework.integration
org.codehaus.mevenide
jdom
com.googlecode.metridoc
org.bouncycastle
org.sonatype.flexmojos
org.glassfish.main
org.ow2.carol.cmi
org.apache.oodt
org.apache.ctakes
org.friendularity
jetty
org.jbundle.util.webapp
org.aspectj
org.languagetool
org.apache.aries.application
org.jboss.microcontainer
javax.transaction
com.ning.billing
org.objectweb.petals
org.apache.geronimo.bundles
com.atlassian.jira.plugins
io.restx
org.geotoolkit.pending
org.glassfish.jersey.examples
org.kevoree.corelibrary.javase
org.scalatra.scalate
org.apache.aries.blueprint
opensymphony
org.nakedobjects.plugins
de.twentyeleven.skysail
de.matrixweb.smaller
net.java.truevfs
org.eclipse.jdt
org.apache.tiles
org.dockingframes
org.glassfish.web
org.kohsuke
info.cukes
com.google.inject.extensions
org.glassfish.main.deployment
org.sonatype.spice.inject
org.ops4j.pax.runner
org.elasticsearch
org.commonjava.aprox
com.tourapp.res
com.tourgeek.res
org.eclipse.jetty.orbit
net.java.trueupdate
org.kuali.maven.plugins
org.scalikejdbc
com.jpattern
org.cleartk
org.jboss.weld
org.linkedin
org.codehaus.modello
org.restlet.jee
org.spockframework
org.ops4j.pax.swissbox
com.enioka.jqm
org.scalesxml
org.jboss.shrinkwrap
org.apache.openjpa
javax.el
eu.cedarsoft.utils
com.cedarsoft.utils
org.openengsb.framework
com.ardor3d
org.fuzzydb
javax.xml
org.codehaus.openxma
net.sf.sociaal
org.jibx.schema.org.opentravel._2013A
org.kie.workbench.screens
org.molgenis
mysql
io.vertx
javax.servlet.jsp
org.crsh
org.apache.npanday
tv.cntt
org.jvnet.hyperjaxb3
org.picketbox
com.propensive
xfire
org.ow2.orchestra.eclipse.equinox
jpox
com.dongxiguo
fr.inria.powerapi.sensor
com.nextapp
eu.stratosphere
net.osgiliath.framework
org.gatein.portal
org.jasig.cas
org.geoserver
org.scalamodules
javax
org.apache.velocity
org.entando.entando.plugins
org.wisdom-framework
org.mobicents.servers.jainslee.enablers
net.jangaroo
org.kuali.common
rhino
org.glassfish.admin
fr.opensagres
br.com.objectos
net.bpelunit
org.smallmind
com.github.myst3r10n
com.vaadin
org.exoplatform.ecms
es.ucm.fdi.grasia.faerie
org.codehaus.sonar.plugins
org.apache.bigtop.itest
org.mortbay.jetty.testwars
org.pegdown
nz.ac.auckland.composite
org.apache.ode
org.kie.commons
org.ow2.sirocco.cloudmanager
org.scala-tools
javax.ws.rs
org.apache.maven.plugin-tools
org.codehaus.izpack
org.scala-stm
javassist
org.apache.chemistry.opencmis
org.marketcetera
org.apache.fulcrum
org.openengsb.connector
org.ow2.jasmine.probe
org.openengsb.domain
net.sf.jung
it.tidalwave.blueshades
org.apithefire
ca.carleton.gcrc
maven-plugins
com.twelvemonkeys.imageio
org.ow2.orchestra
org.powerscala
com.razie
jline
org.ow2.orchestra.eclipse.birt
nanocontainer
commons-configuration
com.github.jknack
org.sonatype.plugins
it.tidalwave.solidblue
org.swinglabs.swingx
org.ow2.jonas.camel
org.ow2.asm
org.hornetq
com.ovea
net.officefloor.plugin
com.sksamuel.scruffy
org.appfuse.archetypes
org.crashub
org.daisy.pipeline.modules.braille
org.jibx.schema.org.opentravel._2013B
com.vividsolutions
org.eobjects.analyzerbeans
org.scalaj
org.imixs.workflow
dk.eobjects.metamodel
org.apache.openwebbeans
mockobjects
net.sf.sido
org.ow2.kerneos
org.hibernate.javax.persistence
org.jboss.javaee
org.elasticmq
org.springframework.data
io.hawt
com.atlassian.sal
org.apache.directory.api
org.deephacks
org.appdapter
org.apache.deltaspike.modules
com.thoughtworks.paranamer
com.alibaba.otter
com.atlassian.maven.plugins
com.github.tminglei
org.daisy.pipeline.modules
org.hippoecm
com.xeiam.xchange
org.ow2.easywsdl
velocity
org.jboss.security
slide
com.redhat.rhevm.api
org.eclipse.wst.common
com.socrata
org.ow2.orchestra.eclipse.core
org.parboiled
org.glassfish.main.web
org.mule.examples
org.simplex3d
org.ow2.mind
com.google.collections
org.gatein.wci
org.xerial
dk.apaq
com.atlassian.streams
org.apache.maven.archiva
org.apache.spark
org.mobicents.servers.media.examples
commons-fileupload
org.scala-tools.sbt
org.jaitools
org.freehep
org.ow2.fractal.juliac.osgi
org.ow2.jonas.osgi
org.hyperscala
it.tidalwave.metadata
com.sun.xml.ws
com.github.marschall
net.sf.squirrel-sql.thirdparty-non-maven
org.glassfish.deployment
net.sf.saxon
org.apache.poi
org.semanticweb.elk
com.github.sebhoss
com.threewks.thundr
com.woorea
org.sakaiproject.common
com.googlecode.etl-unit
org.apache.jclouds.api
net.flexmojos.oss
org.mod4j
com.dadrox
org.jboss.weld.osgi.examples
org.apache.whirr
org.apache.synapse
com.vaadin.external.atmosphere
org.jboss.soa.bpel
org.kevoree.tools
xdoclet-plugins
com.github.spullara.redis
net.sf.squirrel-sql
org.jbundle.util.osgi
org.unitils
org.glassfish.tyrus
net.javacrumbs
org.glassfish.annotations
com.mysema.querydsl
org.hsqldb
org.nuiton.jaxx
org.objectweb.fractal.fractaladl.juliac
com.adobe.flex.compiler
net.sf.ingenias
org.eclipse.ecf
com.google.sitebricks
org.restlet.gae
com.evasion
org.codehaus.wadi
org.apache.myfaces.buildtools
com.threerings
org.gatein.pc
com.atlassian.studio
io.cloudsoft.jclouds.api
nz.net.osnz.common
org.codehaus.mojo.archetypes
org.glassfish.docs.man
org.iplantc
org.jboss.dna
org.jboss.teiid.connectors
org.kill-bill.billing
org.ow2.joram
org.restlet.osgi
edu.stanford.protege
org.apache.xmlbeans
org.eclipse.emf.ecore
info.magnolia
org.glassfish.hk2.external
org.nanocontainer
org.springframework.osgi
org.ow2.monolog
org.sonatype.plexus
org.glassfish.docs.help
org.codehaus.xdoclet
org.codehaus.castor
org.tynamo
com.jcabi
jmock
org.codehaus.jettison
org.apache.geronimo.devtools
org.giavacms
postgresql
org.jboss.marshalling
jfree
org.objectweb.fractal.juliac.osgi
org.openengsb.core
org.jboss.forge.furnace
org.jbehave
com.github.tototoshi
io.dropwizard
john-test
javax.validation
com.github.apetrelli.gwtintegration
org.wicketopia
org.jvnet.hudson.dtkit
com.jolira
org.eclipse.jgit
commons-dbcp
org.jboss.ironjacamar
commons-pool
org.wamblee
com.sun.jersey.contribs
pro.savant.circumflex
org.andromda.cartridges
com.gwtplatform
com.github.dandelion
it.amattioli
com.googlecode.playn
com.googlecode.the-fascinator.plugins
ru.circumflex
com.eed3si9n
org.jboss.aerogear
com.mysema.rdf
org.javassist
com.octo.captcha
org.sonatype.gshell
org.apache.isis.runtimes.dflt
org.atteo
fulcrum
org.apache.olingo
org.jboss.teiid
org.kuali.ole
org.mobicents.servers.sippresence
org.no-hope
org.eobjects.datacleaner
taglibs
com.googlecode.scalaz
org.jboss.weld.osgi
org.apache.myfaces.core
mx4j
org.codehaus.griffon
org.apache.shiro
javax.activation
org.coosproject.messaging
com.ocpsoft.rewrite
net.sourceforge.javydreamercsw
com.googlecode
org.wikbook
org.apache.cactus
org.glassfish.main.security
org.richfaces.ui
org.jboss.shrinkwrap.descriptors
eu.getintheloop
org.chromattic
drools
org.apache.hive
easymock
org.mod4j.org.eclipse.emf
org.cometd.java
com.google.protobuf
com.sun.electric
com.badlogicgames.gdx
net.fwbrasil
net.sf.javagimmicks
org.apache.npanday.plugins
org.apache.sirona
org.epics
org.geomajas.widget
com.borachio
org.jflux
org.swinglabs
org.apache.maven.reporting
org.apache.accumulo
org.ops4j.pax.url
com.mycila
com.googlecode.refit
org.apache.maven.surefire
it.reify
edu.internet2.middleware.psp
org.apache.wink
org.glassfish.pfl
com.atomikos
org.apache.logging.log4j
org.codehaus.sonar-plugins.dotnet
org.apache.myfaces.tobago
org.activiti
com.sun.phobos
net.officefloor.eclipse
org.eclipse.ant
org.spire-math
org.sazabi
com.assembla.scala-incubator
org.jboss.arquillian.graphene
com.findwise.hydra
com.stackmob
org.jvnet
de.huxhorn.sulky
org.jruby
com.googlecode.jeeunit
org.acegisecurity
com.jgoodies
org.freemarker
com.hp.hpl.jena
org.apache.xmlrpc
org.usergrid
com.google.gdata
org.jboss.aop
com.frugalmechanic
com.gu
com.manydesigns
com.pojosontheweb
io.cloudsoft.jclouds.labs
milyn
org.arquillian.extension
org.jibx.schema.org.w3
org.ow2.jonas.jpaas.apache-manager
org.projectlombok
bouncycastle
aopalliance
org.jbundle.base
net.sourceforge.cobertura
com.dyuproject.protostuff
org.broadleafcommerce
commons-jxpath
com.sun.corba
org.hdiv
org.andromda.thirdparty.jaxb2_commons
org.objectweb.fractal.bf
org.codehaus.cjcook
org.ow2.jasmine.jade
org.apache.isis
com.netflix.rxjava
org.apache.juddi
org.sonatype.tycho.p2
net.stickycode.mockwire
com.rojoma
org.ops4j.pax.logging
antlr
org.mod4j.org.eclipse
org.ow2.cmi.osgi
org.jwall
com.novus
com.n3twork.druid
com.thinkaurelius.titan
com.yuvimasory
org.apache.kafka
org.daisy.pipeline
com.github.venkatramanm.swf-all
com.squeakysand
org.kie.workbench.services
com.miglayout
de.extra-standard
org.jboss.seam
org.codeartisans.qipki
com.github.scopt
org.apache.amber
org.sgine
org.jboss.shrinkwrap.resolver
com.samskivert
org.apache.jena
org.apache.jmeter
org.glassfish.main.connectors
org.jodd
com.wadpam.openserver
com.hazelcast
biz.aQute
com.github.datatables4j
org.nuiton
com.sun.jersey.samples
it.tidalwave.blueargyle
jaxme
wsdl4j
org.ninjaframework
org.ow2.sirocco.vmm
com.sangupta
br.com.caelum.vraptor
org.jbpm.jbpm4
org.jibx.schema.ws
org.jumpmind.symmetric
org.guvnor
org.ow2.util.bundles
com.cloudhopper
org.squeryl
org.apache.pluto
com.mojolly.scalate
org.aperteworkflow.contrib
org.gatein.wsrp
org.jboss.dashboard-builder
org.mechio
org.mobicents.servers.xdm
org.mobicents.servers.xdm.core
org.monifu
org.ow2.xlcloud
org.smart4j
org.nuiton.js
com.tristanhunt
org.ow2.wildcat
org.zkoss.zk
org.apache.geronimo.gshell
net.israfil.foundation
org.objectweb.fractal.cecilia.toolchain
com.googlecode.mycontainer
com.github.vario
org.jvnet.hyperjaxb2
fr.inria.powerapi.formula
com.googlecode.sli4j
org.jbundle.thin.base.screen
com.github.gkutiel
org.jetbrains.kotlin
de.devsurf.injection.guice.scanner
net.sourceforge.kivu4j
org.glassfish.main.core
org.objectweb.fractal.fraclet.java
org.objectweb.fractal.bf.connectors
org.apache.cxf.dosgi.samples
org.glassfish.main.persistence.cmp
org.apache.karaf.shell
org.jboss.deployers
org.jbundle.base.screen
org.jbundle.app.program
commons-digester
org.reflext
org.codehaus.jedi
com.github.malliina
net.debasishg
org.grouplens.lenskit
com.jsuereth
org.jbundle.util.calendarpanel
org.appfuse
com.baulsupp.kolja
net.sf.itcb.common
com.ckkloverdos
org.apache.aries.samples.ariestrader
org.jboss.spec.javax.servlet
net.java.truelicense
org.apache.geronimo.ext.aries.blueprint
org.eclipse.osgi
com.google.http-client
com.facebook.presto
com.indeed
com.sandinh
io.ratpack
org.apache.batchee
org.exoplatform.platform
org.kantega.reststop
org.liquibase.ext
org.mobicents.servers.sipevent
org.powermock.examples
spice
uk.org.retep.tools
org.kevoree
org.apache.felix.karaf.shell
org.jbundle.thin.base
com.yammer.dropwizard
eu.cdevreeze.yaidom
org.scalatra.rl
org.eobjects.metamodel
org.objectweb.fractal.mind.compiler
org.powertac
net.smartam.leeloo
java3d
org.ow2.util.maven
nu.zoom.svansprogram
org.eclipse.jetty.aggregate
com.github.stephenc.java-iso-tools
org.apache.aries
org.geomajas.project
net.caladesiframework
org.picketlink.idm
com.github.ryanbrainard
org.apache.logging.log4j.adapters
nu.zoom.desktop
net.sourceforge.findbugs
org.springframework.ws
org.romaframework
org.kasource
com.codahale.metrics
com.m3
com.google.code.maven-play-plugin.org.playframework
org.apache.openejb.patch
de.saumya.mojo
org.mule.tools
javax.cache
org.codehaus.tycho
org.mobicents.servers.media.controllers
org.kuali.student.common
com.mtvnet.boxspring
de.schlichtherle.truezip
com.atlassian.oauth
com.github.ddth
de.learnlib
mevenide
org.javafxdata
org.openscm.kundo.plugins
org.openstreetmap.osmosis
org.sisioh
org.talend.esb
org.fusesource.examples
org.fakereplace
org.geotoolkit
javax.jms
org.databene
org.jbundle.res
org.vert-x
org.jboss.arquillian.protocol
nu.zoom
org.solovyev
org.picocontainer
org.apache.provisionr
io.tesla.maven
com.tourapp.thin
com.tourgeek.thin
com.squareup
ca.uhn.hapi
org.jboss.arquillian.junit
com.amazonaws
org.eclipse.aether
com.atlassian.confluence
backport-util-concurrent
org.metawidget.modules
org.sapia
org.khronos
org.jboss.arquillian.testenricher
org.nakedobjects.core
com.timgroup
org.apache.rampart
com.projectdarkstar.server
org.akubraproject
org.mobicents.servers.media
nz.ac.auckland.common
org.connid
org.ow2.frascati.tinfi.examples
org.objectweb.fractal.bf.examples
com.nitorcreations
net.java.truecommons
org.chenillekit
org.seleniumhq.webdriver
org.sonatype.restsimple
org.picocontainer.script
org.apache.woden
org.apidesign.bck2brwsr
com.atlassian.refapp
com.avast
com.butor
com.github.cb372
com.github.fommil.netlib
com.github.molecule-labs
com.sclasen
eu.agrosense.api
excalibur
marmalade
org.apache-extras.camel-extra
org.apache.karaf.eik.plugins
org.connectopensource
org.ow2.chameleon.fuchsia.examples
org.rwshop
org.scalafx
uk.gov.nationalarchives
net.sf.microlog
net.databinder.spde
org.st-js
com.cloudbees
org.apache.shale
org.quartz-scheduler
org.jbundle.app.office
javax.faces
org.jbundle.base.db
org.specsy
org.codehaus.geb
org.nhind
org.scalariform
com.emsoft
org.exoplatform.jcr
com.jakewharton
org.jvnet.jaxb2.maven2
org.jboss.bpm
org.streum
net.thegodcode
org.sonatype.gossip
com.sun.xml.stream
io.backchat.inflector
com.github.aselab
org.eclipse.uml2
com.google.api-ads
org.openid4java
org.apache.hbase
org.eclipse.jetty.toolchain
it.freshminutes
org.spark-project
org.soitoolkit.commons.poms.mule-dependencies
com.github.jnr
ch.sahits.game
org.sonatype.sisu.goodies
edu.emory.mathcs.util
org.igniterealtime.smack
com.github.edgarespina
org.kuali.student.core
com.ibm.icu
springframework
com.sun.faces
org.apache.maven.plugin-testing
com.fasterxml.jackson.module
org.fuwjin
com.orientechnologies
net.awired.visuwall
org.richfaces.cdk
org.mobicents.cluster
com.peterlavalle
org.jomc
co.paralleluniverse
com.atlassian.gadgets
com.github.micromix
dentaku
edu.uiuc.ncsa.myproxy
li.rudin.rt
net.sourceforge.fuzzyservices
net.tribe7.seeds
org.apache.tuscany.sca.samples
org.jasig.portlet
org.netbeans.external
org.nuxeo.ecm.core
org.scalamacros
org.securegraph
org.sonatype.m2e.extras
org.w3
com.facebook.jcommon
com.cedarsoft
org.ow2.easybeans.tests
org.specrunner
org.apache.onami.converters
com.github.stefanbirkner
net.joala
org.togglz
com.github.spullara.mustache.java
es.prodevelop
org.mybatis
org.tranql
fr.inria.gforge.spoon
org.codehaus.jtstand
net.sf.wsag4j
gov.sandia.foundry
net.sourceforge.floggy
com.barchart.util
net.thucydides
com.github.goldin
org.scala-libs
net.sf.jsptest
com.github.lkoskela.jsptest
org.ow2.shelbie
org.sonatype.gshell.commands
de.tudarmstadt.ukp.wikipedia
org.apache.geronimo.testsupport
org.wymiwyg
org.jibx.schema.org.opentravel._2012A.ws
org.gradle.api.plugins
com.weiglewilczek.slf4s
org.zeromq
org.glassfish.mq
net.fortytwo.sesametools
net.sf.wsag4j.types
org.gaelyk
org.ops4j.gaderian
com.chuusai
cactus
org.eclipse.hudson
org.objectweb.celtix
org.kohsuke.stapler
org.ow2.weblab.core
org.apache.portals.bridges
org.markdownj
org.reddwarfserver.server
org.bluestemsoftware.open.maven.plugin
org.teatrove
org.nakedobjects.examples
org.codehaus.sonar-plugins.dotnet.csharp
org.syphr
org.apache.portals.pluto
org.jasypt
at.newmedialab.ldpath
net.rosien
com.mgmtp.perfload
org.ops4j.pax.web
com.englishtown
com.projectdarkstar.ext.com.jmonkeyengine
org.codehaus.groovy.maven
edu.washington.cs.knowitall
org.ops4j.pax.scanner
org.apache.geronimo.ext.tomcat
net.stickycode.configured
com.atlassian.confluence.test
com.bacoder.jgit
com.github.kmizu
com.github.rmannibucau
com.ibm.sbt
com.lihaoyi
com.payneteasy.superfly
com.xpn.xwiki.products
eu.agrosense.server
eu.agrosense.spi
io.github.benas
io.pelle.mango
it.tidalwave.northernwind.rca
jp.co.ctc-g.jfw
jp.t2v
org.apache.camel.archetypes
org.apache.metamodel
org.craftercms
org.exoplatform.cs
org.exoplatform.ks
org.exoplatform.social
org.fusesource.scalate.samples
org.jboss.maven.plugins
org.jglobus
org.openjdk.jmh
org.ow2.jonas.admin
se.natusoft.tools.codelicmgr
args4j
eu.cedarsoft.commons
org.syncloud
org.fusesource.wikitext
org.defne
org.glassfish.main.cluster
org.ow2.util.asm
org.glassfish.extras
org.glassfish.main.grizzly
net.stickycode.stereotype
org.scalaxb
org.apache.aries.spifly.examples
org.testtoolinterfaces
com.meschbach.psi
org.ow2.frascati.examples.test
org.andromda.maven.plugins
org.ow2.jonas.cxf.transport.reliablejms
org.apache.isis.runtimes.dflt.remoting
org.pitest
org.codeswarm
javax.jdo
org.nuiton.topia
com.googlecode.obvious
org.apache.myfaces.commons
de.agilecoders.wicket
org.bitbucket.t1ck
org.cyclopsgroup
org.eclipse.update
org.springframework.social
org.xcmis
org.exoplatform.kernel
commons-discovery
org.mobicents.tools
com.threerings.nexus
com.jayway.restassured
net.sourceforge.schemacrawler
org.codehaus.mojo.unix
com.github.fge
io.tesla.jettyconsole
net.sf.doolin
org.apache.cxf.dosgi
org.eclipse.jem
org.resthub
com.rabbitmq
org.jboss.snowdrop
com.googlecode.redbox-mint
com.octo.android.robospice
org.restlet
org.jbundle.thin.base.db
com.googlecode.genericdao
org.objectfabric
activesoap
org.apache.jclouds
org.jolokia
org.apache.directory.junit
com.meltmedia.cadmium
com.nicta
org.beanshell
com.rempl
org.batoo.jpa
org.codehaus.fabric3.spec
org.openengsb.wrapped
com.abiquo
com.aceevo.ursus
com.atlassian.applinks
com.atlassian.labs
com.atlassian.selenium
com.barchart.feed
com.belerweb
com.cisco.oss.foundation
com.github.sviperll
com.imageworks.scala-migrations
edu.berkeley.cs.shark
io.cloudsoft.jclouds
io.fabric8.insight
net.officefloor.tutorial
net.sf.ahtutils
org.apache.karaf.cellar
org.cddcore
org.cruxframework
org.deephacks.westty
org.dspace.xmlui.excalibur
org.eclipse.tycho.extras
org.jboss.pressgang.ccms
org.netbeans.html
org.ow2.util.plan
org.rapidpm.modul
org.scala-lang.plugins
org.scala-tools.sxr
org.scalautils
com.cyrusinnovation
com.theoryinpractise
com.github.mvv.routineer
com.tinkerpop.blueprints
javax.jcr
io.spray
es.ucm.fdi.grasia.faerie.demos
org.jamon
org.codelabor
org.jbundle.base.message
org.eclipse.gmf
org.jasig.portal
org.prevayler
org.multiverse
org.codeartisans
net.ulrice
org.apache.tika
com.googlecode.json-simple
org.eiichiro.gig
com.draagon
net.sourceforge.kivu4j.utils
org.apache.geronimo.samples
org.bidib.jbidib
com.uphyca
org.jruby.extras
com.googlecode.jazure
org.glassfish.corba
org.glassfish.security
org.glassfish.connectors
org.codehaus.gmaven.runtime
org.sonatype.http-testing-harness
org.codehaus.groovy.maven.runtime
org.znerd
com.googlecode.flyway
net.sourceforge.htmlunit
org.parancoe
org.jboss.netty
net.sourceforge.jeuclid
org.eclipse.gmf.runtime.common
net.vvakame
org.ow2.fractal.bf
com.l2fprod.common
com.cibuddy
com.mysema.commons
org.gnieh
no.uis.nio
jivesoftware
com.github.axet
org.jbundle.main
org.ops4j.pax.cdi
org.jibx.schema.org.opentravel._2012B.ws
org.jboss.weld.osgi.examples.userdoc
com.lemoulinstudio.jnag
eu.larkc.csparql
com.netflix.curator
org.sonatype.security
com.liferay.portal
org.glassfish.jersey.ext
org.ops4j.pax.exam.samples
org.terracotta
org.apache.avro
com.sun.woodstock.dependlibs
org.srplib
commons-net
com.google.api-client
org.jbpm.jbpm3
com.hmsonline
org.apache.excalibur.components
org.codehaus.sonar.sslr
org.apiwatch
org.ow2.fractal.bf.examples
acegisecurity
beehive
ch.inftec.ju
ch.netcetera.eclipse
com.alibaba.rocketmq
com.atlassian.activeobjects
com.atlassian.analytics
com.atlassian.bamboo.plugins
com.dooapp
com.github.ansell.pellet
com.github.kristofa
com.googlecode.openbox
com.graphaware.neo4j
com.lyncode
com.typesafe.genjavadoc
de.johoop
excalibur-fortress
fr.inria.eventcloud
io.fabric8.archetypes
io.fabric8.examples
nl.grons
org.apache.cxf.systests
org.apache.geronimo.gshell.commands
org.apache.maven.archetypes
org.apache.river
org.exoplatform.ws
org.gatein.sso
org.geomajas.documentation
org.jibx.schema.org.opentravel._2013A.ws
org.kevoree.corelibrary.android
org.openl
org.ow2.weblab.service
org.pac4j
org.projectodd.stilts
org.scala-saddle
org.sculptorgenerator
org.simplericity.jettyconsole
org.skinny-framework
org.spark-project.hive
org.xwiki.enterprise
se.skltp.vp
sk.tuke.yajco
org.jpmml
org.exoplatform.core
org.apache.bookkeeper
org.codehaus.groovy.modules.scriptom
org.dataglot
org.dspace.dependencies.solr
com.atlassian.xmlrpc
net.sf.grinder
org.apache.servicemix.kernel.gshell
com.vecna
de.fuberlin.wiwiss.silk
com.github.siasia
org.glassfish.embedded
com.github.danny02
org.jboss.weld.servlet
org.constretto
org.ow2.jonas.jpaas.util.cloud-desc
com.tacitknowledge
nl.trivento.albero
com.custardsource.parfait
groovy
axis
com.fasterxml
org.liquibase
net.incongru.berkano
com.ovh.ws
org.zanata
org.apache.myfaces.extensions.cdi.modules
org.glassfish.main.external
org.apache.bval
org.skyscreamer
de.devsurf.injection.guice
com.codeslap
net.sandrogrzicic
com.github.insubstantial
org.efaps
net.awired.ajsl
org.objectweb.fractal.cecilia
com.darylteo
org.ow2.opensuit
de.intarsys.opensource
org.codehaus.sonar-plugins.java
org.graphstream
org.codehaus.plexus.registry
com.mfizz
org.glassfish.persistence.cmp
org.swixml
com.strategicgains
net.sf.patterntesting
openejb
net.derquinse
org.jboss.arquillian.ajocado
it.tidalwave.bluebill.android
xom
org.jooq
org.reflections
org.apache.james.protocols
wicket
avalon
org.apache.gora
com.microsoft.windowsazure
rome
org.apache.tuscany.sca.shades
org.eclipse.jface
org.apidesign.html
org.testatoo.container
org.sodatest
com.fasterxml.storemate
com.googlecode.apparat
org.apache.cayenne
org.mobicents.diameter
org.jsslutils
org.python
dk.apaq.printing
org.brillien
org.springmodules
com.lordofthejars
org.codehaus.gmaven
org.eclipse.jetty.osgi
com.sksamuel.scrimage
org.javasimon
org.eclipse.jetty.spdy
org.fusesource.mvnplugins
org.ow2.jonas.cxf.transport.mdb
org.apache.mahout
org.apache.pdfbox
com.github.dimovelev
com.github.hburgmeier.jerseyoauth2
com.googlecode.flyway-test-extensions
com.impetus.kundera.client
com.liferay.maven.archetypes
controlhaus
de.mhus.lib
fr.figarocms.flume
im.bci
io.apigee.trireme
io.webcrank
net.fishear
net.fortytwo.extendo
nz.co.senanque
org.apache.archiva.redback
org.apache.geronimo.plugins
org.apache.hive.hcatalog
org.apache.oltu.oauth2
org.apache.tajo
org.bidib.jbidib.swinglabs.swingx
org.cometd.archetypes
org.copper-engine
org.eclipse.xtext
org.everit.osgi
org.jboss.blacktie
org.jboss.identity
org.jibx.schema.org.opentravel._2013B.ws
org.mock-server
org.onebusaway
org.openwfe
org.orbisgis
org.ow2.util.metadata
org.ow2.weblab.tools.maven
org.restlet.android
org.switchyard.console
ru.primetalk
ru.yandex.qatools.allure
com.fluxcorp.plugins
org.daisy.libs
com.paypal.sdk
org.jsoup
org.objectweb.fractal.bf.testing
org.mobicents.servlet.sip.containers
se.vgregion.commons-util
org.apache.ws.jaxme
org.mod4j.crossx
uk.ac.rdg.resc
javax.sip
org.glassfish.main.extras
net.sf.testium
org.glassfish.main.ejb
org.jboss.kernel
org.glassfish.core
org.ow2.util.log
com.agical.rmock
com.googlecode.guava-osgi
org.glassfish.main.persistence
net.sf.buildbox
org.atmosphere.extensions
org.connid.testbundles
com.martiansoftware
com.github.jmkgreen.morphia
c3p0
com.fasterxml.jackson.datatype
org.htmlparser
org.jboss.ws.native
org.semispace
org.jboss.weld.osgi.tests
com.github.rwl
org.jvnet.hudson.pxeboot
org.twitter4j
org.jboss.integration
org.fusesource.jansi
org.jboss.metadata
org.semweb4j
org.simpledbm
org.apache.odftoolkit
org.springframework.webflow
org.gebish
net.stepniak.api
com.itextpdf
org.apache.geronimo.samples.daytrader.modules
com.taobao.metamorphosis
org.codehaus.mojo.groovy
org.jboss.modules
com.github.yroffin
org.yestech
com.alkacon
org.jvnet.sorcerer
org.jsonddl
com.heroku.api
org.yaml
net.sf.jguard
org.objectweb.fractal.juliac.examples
org.ow2.jasmine.rules
org.jogamp.jogl
genjava
findbugs
org.ow2.petals.wsstar.oasis-ws-basefaults
org.codehaus.service-conduit.spec
org.apache.jclouds.driver
org.apache.rave
jp.objectfanatics
org.jibx.config.3rdparty.org.eclipse
org.sonatype.nexus.tools
org.glassfish.main.tests
com.actionbarsherlock
org.agorava
org.apache.ws.commons.schema
org.apache.geronimo.samples.javaee5
it.tidalwave.semantic
org.avaje
org.glassfish.main.transaction
com.twitter.elephantbird
com.mockrunner
org.abstractmeta
org.ancoron.postgresql
org.mule.tests
au.com.dius
berkano
com.atlassian.maven.archetypes
com.github.jlgrock.javascript-framework
com.github.rhyskeepence
com.metsci.glimpse
com.moviejukebox
de.holisticon.util.tracee
de.weltraumschaf.commons
dk.navicon
fr.matthieu-vergne
io.cloudsoft.jclouds.driver
io.fabric8.runtime
io.tracee
net.adamcin.httpsig
net.kuujo
net.leadware
nz.net.osnz.composite
oness
org.agiso.tempel.templates
org.apache.wss4j
org.codehaus.hydra-cache
org.drombler.acp
org.duelengine
org.fluttercode.knappsack
org.fusesource.scalate.tooling
org.jboss.capedwarf.green
org.jboss.identity.idm
org.jboss.narayana.blacktie
org.jdtaus
org.moskito
org.ops4j.pax.carrot
org.ops4j.pax.web.samples
org.overturetool.core
org.ow2.xlcloud.xms.console
org.savara.bundles
org.smartparam
org.switchyard.quickstarts.demos
ru.dmerkushov
org.whizu
net.sf.testngdatabind
net.java.dev.gluegen
org.apache.axis
aspectj
org.opencredo.cloud.storage
org.jboss.bootstrap
net.craftforge.essential
org.apache.shindig
org.sat4j
org.apache.servicemix.nmr
org.axonframework
com.yahoo.platform.yui
org.jboss.cache
org.jboss.arquillian.daemon
com.googlecode.wicketelements
com.googlecode.kiama
org.ow2.frascati.factory
org.apache.sandesha2
org.sonatype.maven.shell
edu.internet2.middleware.grouper
org.mockwire
org.jasig.sched-assist
org.codehaus.gant
org.jboss.mod_cluster
com.github.aloiscochard.sindi
com.dtrules
javax.batch
dk.apaq.framework
org.carrot2
com.wadpam.gaelic
org.jboss.spec.javax.transaction
org.apache.aries.jndi
poi
net.sf.json-lib
myfaces
javax.ejb
org.eclipse.wst
com.google.code.plsqlmaven
com.espertech
javax.xml.soap
net.myrrix
com.lowagie
org.apache.myfaces.extensions.scripting
struts
org.coosproject
org.jboss.webbeans
com.noelios.restlet
org.sejda
org.icefaces
com.intellij
net.sf.opencsv
com.github.mcpat.apistubs
de.taimos
org.robolectric
org.sonatype.p2.bridge
javax.jws
org.eclipse.uml2.diagram
br.net.woodstock.rockframework
org.seleniumhq.selenium.client-drivers
org.apache.aries.samples.blog
org.jdtaus.common
org.jboss.weld.se
org.jvnet.jax-ws-commons
swt
pl.iogreen.lols
com.seovic.coherence
org.jboss.unit
pl.bristleback
org.apache.beehive
barsuift.simLife
org.jdtaus.banking
org.picocontainer.web
org.ow2.sat4j
org.springframework.batch
com.cedarsoft.serialization
com.earldouglas
org.apache.geronimo.buildsupport
com.netflix.astyanax
org.eclipse.scalamodules
org.boretti.drools.integration
com.sun.istack
org.apache.avalon.framework
org.eclipse.jst.j2ee
de.viaboxx
org.nuiton.thirdparty
org.andromda
org.scala-tools.time
com.mycila.testing.plugins
org.apache.aries.jmx
org.commonjava.shelflife
org.jboss.ws.cxf
org.sonatype.pmaven
org.jboss.test
org.jibx.schema.org.opentravel.example.jbundle
org.commonjava.tensor
org.glassfish.scripting
com.github.goldin.plugins.gradle
com.googlecode.kevinarpe-papaya
org.ow2.play
org.kaleidofoundry
com.technophobia.substeps
org.jbpm.spec
org.parallelj
org.springframework.ldap
org.jarbframework
org.jboss.byteman
com.netflix.karyon
org.apache.clerezza.ext
net.jakubholy.jeeutils.jsfelcheck
org.eclipse.ecf.provider
net.sourceforge.jwebunit
org.jboss.logmanager
com.aceevo
com.atlassian.myworkday
com.blacklocus
com.danhaywood.isis.wicket
com.daveayan
com.getperka.flatpack
com.jetdrone
com.mattunderscore
com.mosesn
com.netflix.hystrix
com.nimbusds
com.orange.redis-protocol
com.qspin.qtaste
com.thoughtworks.inproctester
com.typesafe.play
com.typesafe.scala-logging
com.versal
com.xpn.xwiki.platform.plugins
de.otto
gr.jkl
info.archinnov
io.kamon
io.provis
me.mindwind
nanning
net.automatalib
net.osgiliath.hello
org.abstractform
org.akhikhl.gretty
org.apache.directmemory
org.apache.jackrabbit.vault
org.apache.karaf.management.mbeans
org.apache.servicemix.itests
org.boofcv
org.calrissian.accumulorecipes
org.crazyyak.dev
org.deeplearning4j
org.gridkit.lab
org.ikasan.demo
org.impalaframework
org.jclouds.karaf
org.kevoree.corelibrary.sky
org.kevoree.library.java
org.mobicents.servers.jainslee.tools
org.neo4j.build
org.ow2.chameleon.fuchsia.importer
org.scalatra.scalate.samples
org.walkmod
se.skltp.mb
tmporb
org.kasource.kaevent
org.scala-lang.virtualized
se.vgregion.javg.poc.schema-versioning
asia.stampy
org.codehaus.fabric3.api
org.opencredo.esper
org.ow2.easybeans.examples.maven.jpa2
de.plushnikov.lombok-intellij-plugin
org.objectweb.carol
org.eclipse.debug
org.codehaus.fabric3.standalone
org.domdrides
org.ow2.carol
org.rogach
org.msgpack
org.mortbay.jetty.toolchain.unix
net.awired.clients
org.mobicents.arquillian.container
com.sun.jersey.jersey-test-framework
com.pi4j
org.eclipse.jetty.websocket
com.googlecode.the-fascinator
net.sf.jmatchparser
com.googlecode.jpattern
org.kuali.student.lum
org.mobicents.servers.media.codecs
com.googlecode.wicket-jquery-ui
org.holoeverywhere
org.kuali.kfs
org.codehaus.mojo.groovy.runtime
com.sleepycat
com.apitrary
org.glassfish.jersey.media
org.sonatype.nexus.restlight
com.sun.mail
org.ow2.fractal.bf.connectors
org.codehaus.swizzle
org.eclipse.wst.common.project.facet
com.cognifide.slice
com.github.mcpat.slf4j
org.apache.yoko
concurrent
net.lightbody.able
org.trailsframework
org.apache.geronimo.components
org.jbundle.app.test
net.sf.kxml
org.appspy.server
org.objectweb.think.minus
org.openoffice
org.apache.aries.transaction
com.cueup.hegemon
org.apache.maven.archetype
org.glassfish.jersey.containers
org.jasig.cas.client
org.wamblee.glassfish
storm
org.ow2.orchestra.console
org.codeartisans.thirdparties.swing
se.vgregion.HsaTools
org.sakaiproject.entitybroker
jotm
org.apache.ws.commons.util
org.jboss.jbossts
io.argonaut
com.jhlabs
org.99soft.guice
org.beangle.commons
it.unimi.dsi
org.odata4j
com.github.dblock.waffle
at.molindo
org.coosproject.examples
com.liferay.faces
kg.apc
org.rhq.helpers
org.jboss.msc
org.tmatesoft.svnkit
org.apache.geronimo.daytrader.modules
org.eclipse.gmf.runtime.diagram.ui
org.apache.openejb.maven
net.sf.proguard
uk.co.bssd
org.jboss.cluster
net.sf.mardao
org.apertereports
org.iternine
org.jbehave.web
no.arktekk.unix
com.lambdaworks
org.esigate
org.pingel
com.googlecode.jbp
org.apache.aries.proxy
com.jidesoft
org.apache.photark
org.eclipse.team
org.nisshiee
me.soliveirajr
xmlbeans
de.javakaffee.msm
com.sirika.pymager
org.ogce
com.nhncorp.ntaf
com.github.kevinsawicki
org.nuiton.eugene
org.kite9
wadi
com.azaptree
org.apache.myfaces.extensions.cdi.bundles
com.sun.faces.extensions
com.alibaba.citrus.tool
com.jgeppert.struts2.jquery
com.envoisolutions.sxc
org.nuxeo.runtime
org.ow2.docdoku
org.mobicents.external.freetts
org.apache.crunch
axis2
org.tynamo.security
com.atlassian.plugins.rest
org.knowhowlab.osgi
aspectwerkz
avalon-logging
avalon-util
br.com.caelum.stella
com.atlassian.mywork
com.atlassian.templaterenderer
com.edugility
com.facebook.swift
com.fasterxml.transistore
com.github.agmenc
com.github.cloudfoundry-community
com.github.flowersinthesand
com.github.greengerong
com.github.rinde
com.github.wuic
com.impetus.client
com.ironoreserver
com.kurento.kmf
com.netflix.denominator
com.newzly
com.oracle.coherence.incubator
com.rexsl
com.socklabs
com.sun.grizzly.samples
com.vladmihalcea.flexy-pool
de.vorb
eu.ralph-schuster
io.backchat.rl
io.fabric8.fab.tests
io.higgs
io.pivotal
io.tesla.polyglot
li.rudin.jjst
net.objectlab.kit
net.osgiliath.archetypes
net.virtual-void
org.aktivecortex
org.apache.directory.mina
org.apache.jspwiki.wikipages
org.apache.logging.log4j.osgi
org.apache.openejb.staticweb
org.apache.sqoop
org.apache.syncope
org.apache.tez
org.bekwam
org.commonjava.maven.galley
org.eclipse.virgo.util
org.enhydra.xmlc
org.entando.entando
org.fusesource.fabric.fab.tests
org.glassfish.build
org.glassfish.grizzly.samples
org.graniteds.archetypes
org.grouplens.common
org.jboss.osgi.bundles
org.jboss.spec.archetypes
org.jfxtras
org.jrebirth.af
org.kill-bill.commons
org.mapsforge
org.mobicents.resources.jcc
org.objectweb.fractal.fraclet.java.examples.advanced
org.ow2.chameleon.fuchsia.discovery
org.ow2.easybeans.persistence
org.pustefixframework.maven.plugins
org.qsardb.conversion
org.safehaus.jettyjam
org.sakaiproject.samigo
org.scalastyle
org.treetank
org.wiperdog
ru.stqa.selenium
spring
us.codecraft
wsrf
org.jvnet.hudson.plugins.hudsontrayapp
net.minidev
org.codehaus.sonar-plugins.dotnet.tools
com.carrotsearch
org.ow2.jotm
org.codehaus.mojo.webstart
com.sun.xml.fastinfoset
com.ymock
com.google.code.morphia
org.codehaus.grepo
org.fluentd
org.apache.aries.jpa
org.apache.aries.testsupport
org.eclipse.xsd
no.tornado.brap
org.mozilla
com.github.httl
org.omnaest.utils
com.sun.enterprise.auto-depends-test
org.glassfish.hk2.auto-depends-test
org.apache.isis.progmodels
org.apache.cassandra
com.github.microon
org.soitoolkit.commons.poms
ch.qos.logback.contrib
ch.agent
fi.jumi
javax.portlet
com.sirika.hchelpers
org.apache.excalibur.containerkit
org.codehaus.janino
com.canoo.dolphin
org.hudsonci.stapler
org.objectquery
com.rogiel.httpchannel.services
com.wesleyhome.johksoftware.resource
org.wandledi
com.mtvnet.boxspring.osgi
com.typesafe.slick
com.revelytix
org.hibernate.ogm
org.xerial.java
com.caucho
org.ow2.odis
org.jibx.schema.org.opentravel._2011B.ws
org.sweble.wikitext
com.sencha.gxt
org.sakaiproject.nakamura
org.ow2.orchestra.eclipse.datatools
org.eclipse.sisu
org.ow2.jonas.assemblies
net.nullschool
org.jboss.forge.furnace.container
org.openfeed.proto
com.mycila.com.google.inject
org.drools.planner
org.e-hoffman.testing
net.stickycode.ws
org.nuunframework
org.jboss.osgi.framework
net.sf.jour
no.arktekk
com.codecommit
org.apache.isis.tck
javax.xml.ws
org.extrema-sistemas
org.apache.tomcat.embed
javax.cache.implementation
com.carrotgarden.osgi
org.api-typeable-pojos
org.jboss.arquillian
org.xbean
com.nominanuda
com.ocpsoft.common
org.chtijbug.drools
org.softsmithy.lib
es.ucm.fdi.grasia.faerie.examples
com.tocea.easycoverage
com.thetransactioncompany
net.java.dev.vcc.thirdparty
org.fluentlenium
org.sakaiproject.portal
org.jboss.arquillian.core
com.agilejava.blammo
br.com.ingenieux.launchify
org.codehaus.waffle
com.googlecode.rocoto
org.shoal
org.scalaquery
org.apache.tuscany.sdo
org.apache.cxf.dosgi.systests
org.apache.felix.gogo
org.sonatype.p2.touchpoints
com.github.simplyscala
org.apache.hivemind
net.oauth.core
org.jasig.openregistry
org.jboss.spec.javax.ejb
com.kenai.swingjavabuilderext
org.mobicents.media.codecs
pl.project13.scala
de.fau.cs.osr.ptk
br.gov.frameworkdemoiselle
net.gcolin.httpquery
com.github.mdr
org.scala-tools.sbinary
org.kuali.student.db
com.google.code.simple-spring-memcached
org.apache.karaf.archetypes
org.bluestemsoftware.open.eoa.ext
org.openbel
org.jvnet.jaxbcommons
org.glassfish.cluster
org.avaje.metric
org.ow2.dragon
net.nicholaswilliams.java.licensing
com.github.jsuereth.scala-arm
org.glassfish.main.resources
com.agilejava.docbkx
com.newmainsoftech
org.jasig.portlet.utils
fr.inria.powerapi.listener
org.solovyev.android
commons-vfs
com.cedarsoft.rest
com.fifesoft
org.testinfected.hamcrest-matchers
org.apache.myfaces.shared
org.samba.jcifs
org.ops4j
de.flapdoodle.embed
woodstox
org.apache.karaf
com.atlassian.extras
com.azavea.geotrellis
com.btmatthews.atlas
com.buschmais.cdo
com.buschmais.jqassistant.plugin
com.clearnlp
com.danieltrinh
com.digitalpebble.behemoth
com.eclipsesource.jaxrs
com.fasterxml.clustermate
com.github.ansell.owlapi
com.github.julien-truffaut
com.github.ksoichiro
com.github.mfornos
com.github.mrstampy
com.github.ptgoetz
com.github.sebrichards
com.google.code.greaze
com.google.code.jscep
com.hubspot
com.massrelevance
com.mgmtp.jfunk
com.mycila.guice.extensions
com.netflix.nebula
com.nflabs.zeppelin
com.nocandysw
com.nrinaudo
com.ocpsoft
com.qifun
com.qmetric
com.qulice
com.sun.portal.portletcontainer
com.tngtech.jgiven
com.xpn.xwiki.platform
dalma
de.mhus.osgi
eu.limetri.client
fr.openwide.nuxeo.commons
io.brooklyn.example
io.github.flowersinthesand
io.joynr.java.messaging
io.selendroid
io.takari
it.unibz.inf.ontop
net.conquiris
net.evilengineers.templates4j
net.fortytwo.ripple
net.java.dev.activeobjects
net.onedaybeard.artemis
org.apache.cxf.xjcplugins
org.apache.jclouds.karaf
org.apache.myfaces.trinidadbuild
org.apache.solr.solr
org.apache.twill
org.codehaus.sonar-ide.eclipse
org.codehaus.sonar-plugins.l10n
org.codelibs
org.drombler.fx
org.eclipse.hudson.plugins
org.ferris
org.ff4j
org.fusesource.insight
org.glassfish.jaxb
org.greencheek.related
org.immutables
org.javaz
org.jboss.on
org.jboss.portal.portlet
org.jomc.build
org.jscala
org.mashupbots.socko
org.modeone
org.mongodb.morphia
org.openfuxml
org.openmuc
org.optaplanner
org.projectreactor
org.pustefixframework
org.qsardb.cargo
org.robovm
org.s1-platform
org.sbuild
org.scijava
org.test4j
org.webframe
org.wikidata.wdtk
org.wingsource
org.woelker.jimix
org.zkoss
se.gawell
se.skltp.adapterservices.insuranceprocess.healthreporting
me.springframework
org.codehaus.xsite
net.disy.legato
com.github.sarxos
com.squareup.retrofit
org.kualigan.kfs
net.java.dev.jogl
com.github.jpaoletti
org.jasig
org.apache.ivy
org.jfree
hibernate
com.github.seratch.taskun
pl.iogreen.scalapi
ognl
com.mchange
org.apache.flume
com.proofpoint.galaxy
org.xml-cml
servicemix
com.pyx4me
org.metatype.sxc
org.glassfish.ha
com.fasterxml.jackson.dataformat
org.jclouds.common
dk.apaq.filter
org.ow2.orchestra.eclipse.emf
org.codehaus.gmaven.feature
org.ow2.util.i18n
com.webimageloader
org.piccolo2d
org.mule
org.jboss.solder
tapestry
net.darkmist.alib
com.ibm.batch
jgoodies
net.sf.jalarms
org.andromda.translationlibraries
org.apache.torque
cc.spray
org.jomc.logging
org.odftoolkit
org.jboss.osgi.resolver
org.eclipse.wst.server
org.apache.geronimo.samples.osgi
org.codehaus.cake.test
jgroups
org.jacorb
com.vii.brillien
httpunit
com.sun.jsftemplating
org.zkoss.common
com.google.oauth-client
org.apache.servicemix.jbi
org.ow2.weblab.core.helpers
com.kryshchuk.maven.plugins
org.dspace.xmlui
org.eclipse.jdt.core.compiler
com.googlecode.jsonschema2pojo
com.github.snowdream.android
net.sf.click
org.sadiframework
net.sourceforge.basher
org.siqisource.agave
org.ccil.cowan.tagsoup
com.force.sdk
org.mobicents.media.endpoints
org.jboss.man
org.codehaus.redback.components.cache
com.github.mcpat.libxjava
org.apache.pig
org.apache.ws.commons
org.agmip
net.lag
com.github.ansell.semargl
org.commonjava.maven
com.sun.messaging.mq
net.sourceforge.mydoggy
com.jramoyo.flowee
org.fusesource.leveldbjni
com.google.code.guice
net.sf.retrotranslator
org.scala-tools.sindi
org.coosproject.plugins
com.github.nscala-time
com.github.criccomini
org.jboss.osgi.repository
net.java.dev.msv
com.zaubersoftware.commons
org.mod4j.org.apache.commons
commons-validator
uk.org.lidalia
com.ibm.jbatch
org.avaje.ebeanorm
org.sonatype.plugin
org.objectweb.fractal.fscript
org.scalastuff
org.jboss.test-harness
org.glassfish.main.virtualization
com.ning.jetty
org.apache.isis.runtimes.dflt.objectstores
com.crawljax
org.dbunit
se.vgregion.daoframework
org.jdtaus.core
org.apache.hcatalog
org.sakaiproject.search
javax.resource
org.xerial.thirdparty
com.fasterxml.jackson.jaxrs
org.kie.workbench.widgets
com.cocosw
com.blazebit
com.cedarsoft.wicket
org.jvnet.hudson.svnkit
xmlrpc
org.talend.esb.job
com.trigonic
org.jboss.arquillian.osgi
org.web4thejob
org.codehaus.fabric3.weblogic
org.glassfish.main.javaee-api
jboss.web
org.apache.bcel
org.kohsuke.metainf-services
org.fitnesse
org.ow2.novabpm.admin
com.simple
com.sun.jersey.glassfish.v3.osgi
org.lifty
net.java.sezpoz.demo
com.github.jsr-330
org.sakaiproject.edu-services.sections
org.apache.geronimo.blueprint
org.jboss.mx
org.apache.curator
org.kuali.db.impex
org.codehaus.groovy.maven.feature
me.icymint
com.sun.woodstock
org.commonjava.couch
net.sf.tacos
org.jboss.jsfunit
org.apache.ftpserver
org.eclipse.ui.workbench
eclipse
org.eclipse.xtend
net.ericaro
org.metawidget.modules.faces
com.android.tools.build
org.hobsoft.entangle
org.xhtmlrenderer
net.sf.trove4j
org.commonjava.emb
org.apache.hama
org.connid.bundles
io.tesla
org.apache
org.ow2.fractal.bf.testing
bsh
com.inspire-software.lib.dto.geda
net.sf.bluecove
org.rococoa
org.xeustechnologies
org.jboss.seam.persistence
org.ow2.chameleon
org.eclipse.pde
com.carrotgarden.maven
com.ibatis
com.mongodb.casbah
net.redora
org.apache.portals
com.googlecode.t7mp
org.ow2.fractal
ch.hortis.sonar
org.dspace.discovery
org.jbundle.util
commons-jexl
br.com.caelum
com.kaching.platform
altrmi
antler
at.molindo.social
br.com.ingenieux
coconut
com.addthis
com.aranea-apps.android.libs
com.atlassian.aui
com.atlassian.manager
com.blacklocus.queue-slayer
com.brsanthu
com.btmatthews.maven.plugins.ldap
com.cemerick
com.devbliss
com.dslplatform
com.emc.vipr
com.github.akiraly.reusable-poms
com.github.kschuetz
com.github.markusbernhardt
com.github.odavid.maven.plugins
com.github.sebhoss.doxia
com.github.zqq90.webit-script
com.gnizr
com.google.code.sbt-compiler-maven-plugin
com.google.errorprone
com.googlecode.rapid-framework
com.heroku.platform.api
com.jayway.maven.plugins.android.generation1.plugins
com.jteigen
com.lapis.jsfexporter
com.mycila.com.google.inject.extensions
com.mytdev
com.netaporter
com.netflix.feign
com.ning.billing.commons
com.omertron
com.ontology2
com.pongr
com.prezi.spaghetti
com.rometools
com.sksamuel.jqm4gwt
com.strategicgains.plugin-express
com.tr8nhub
com.willowtreeapps
de.akquinet.android.archetypes
de.is24.common
de.skiptag.roadrunner
de.xwic.jwic
edu.washington.cs.types.checker
io.pkts
io.rudin.webdoc
io.teknek
io.tesla.maven.plugins
io.undertow
net.bolbat
net.derquinse.bocas
net.mikera
net.osgiliath.wrappers
net.simonvt
nz.ac.auckland.lmz
openim
org.aerysoft.miniclient
org.agmip.translators
org.apache.any23
org.apache.cxf.services.xkms
org.apache.karaf.webconsole
org.apache.onami.logging
org.autotdd
org.bsc.maven
org.bytedeco.javacpp-presets
org.cinchapi
org.commonjava.maven.plugins
org.debux.webmotion
org.devzendo
org.drombler.commons
org.echocat.jomon
org.echocat.jomon.net
org.eu.acolyte
org.glassfish.jersey.test-framework.providers
org.infinispan.server
org.javalite
org.jboss.messaging
org.jboss.portletbridge.archetypes
org.jvnet.hudson.tools
org.jvnet.jaxbvalidation
org.kevoree.platform
org.kualigan.maven.plugins
org.ldaptive
org.mobicents.servers.diameter
org.mobicents.servlet.sip.example
org.mule.distributions
org.nalloc
org.neo4j.build.plugins
org.open-dolphin
org.openengsb.framework.ekb
org.openengsb.ui
org.ops4j.pax.jdbc
org.opt4j
org.patterntesting
org.pustefixframework.samples
org.rundeck
org.saintandreas
org.scalawag.timber
org.semarglproject
org.slick2d
org.st-js.bridge
org.structr
org.uiautomation
pubscribe
ua.mobius.media.codecs
ws-commons
org.apache.servicemix.examples.bridge
org.apache.servicemix.examples.loan-broker
org.whitesource
org.fusesource.fabric.fabric-examples
org.jcommon
it.tidalwave.netbeans.boot
org.jibx.schema.org.jibx
com.moparisthebest.aptIn16
org.easyb
org.glassfish.persistence
net.stickycode.configuration
directory-naming
org.codehaus.jsr166-mirror
org.commonjava.web
net.smartlab.web
org.jclarion
net.stickycode.scheduled
org.mobicents.protocols.ss7.management
org.eclipse.jst
net.sf.dozer
com.adaptrex
org.apache.isis.security
org.glassfish.flashlight
org.apache.droids
org.coconut.cache
nu.validator.htmlparser
org.opengis
com.github.scalapi
org.abego.treelayout
org.nuiton.jrst
net.avh4.util
us.levk
org.apache.thrift
org.robotframework
picocontainer
org.sonatype.appbooter.plexus-booters
org.apache.zookeeper
org.codehaus.redback.components
net.sf.jnati
org.eclipse.ocl
eu.cedarsoft.devtools
org.ow2.jonas.tools.configurator
org.simpleframework
org.apache.myfaces.tomahawk
net.java.dev.jets3t
org.apache.geronimo.javamail
org.glassfish.main.jms
org.nuiton.i18n
org.eclipse.help
org.jboss.scanning
de.jiac.micro.platforms.cldc
edu.ucar
com.telly
org.cthul
javolution
junit-addons
org.polyforms
com.ocpsoft.logging
com.github.sbocq
com.barchart.wrap
org.codeartisans.spicyplates
com.custardsource.dybdob
nekohtml
org.apache.click
pl.ais.commons
org.midao
org.opencoweb
org.opensmpp
javax.measure
org.jasig.resourceserver
com.mykate-soft
commons-modeler
org.jvnet.hypercompass
com.alibaba
net.jawr
org.owasp
org.mvel
org.lwjgl.lwjgl
org.apache.deltaspike.core
com.sun.codemodel
org.glassfish.transaction
org.eclipse.wst.xml
org.jfrog.buildinfo
org.apache.vysper
net.sf.seaf
org.enmas
com.googlecode.boost-maven-project
org.apache.tomcat.maven
org.codehaus.mojo.natives
com.augusttechgroup
com.googlecode.ssd-utils
org.zdevra
org.jbundle.thin.main
net.agile-automata.nio4s
org.bluestemsoftware.open.maven.tparty
com.sun.japex
com.sun.pkg
cc.co.scala-reactive
org.objectweb.fractal.fractaladl.examples
com.projectdarkstar.client
org.jboss.arquillian.test
org.jacoco
com.netflix.servo
org.objectweb.fractal.juliac.osgi.examples
org.brickred
com.googlecode.wicked-charts
org.brillien.streamline
org.eclipse.wst.command.env
com.facebook.giraph.hive
org.mobicents.servlet.sip.examples
com.netflix.archaius
org.kohsuke.jinterop
org.nutz
org.apache.felix.karaf
org.eclipse.emf.mapping
org.apache.aries.spifly
msv
com.antwerkz.sofia
com.cloudbees.sdk
net.oneandone
org.apache.helix
org.assertj
org.codehaus.plexus.cache
de.devsurf.injection.guice.integrations
com.googlecode.soundlibs
flux
org.andromda.metafacades
hu.kazocsaba.math
org.jboss.switchboard
org.prevayler.extras
eu.future-earth.gwt
net.java.dev.spring-annotation
org.reddwarfserver.client
org.commonjava.util
org.sonatype.sisu.siesta
net.sourceforge.nekohtml
org.apache.jdo
ro.isdc.wro4j
ca.grimoire
net.elehack.argparse4s
org.jboss.arquillian.spock
com.github.htfv.maven.plugins
org.jadira.usertype
org.fusesource.scalamd
saxon
jcifs
com.sap.odata
quartz
org.cogroo
org.apache.aries.samples.blueprint.helloworld
com.github.kxbmap
com.mysema.scalagen
com.squareup.okhttp
net.databinder.giter8
org.zkoss.zkforge
fr.assoba.open
org.jboss.test-jsf
org.glassfish.main.flashlight
org.jboss.shrinkwrap.container
org.imajine.image
com.googlecode.usc
org.vafer
org.wicketstuff.scala
net.sourceforge.jfacets
org.ops4j.pax.cdi.samples
xbean
com.zaubersoftware.commons.web
com.nesscomputing.mojo
org.jboss.embedded
net.sf.scannotation
javax.media
org.jasig.service
org.eintr.loglady
org.jvnet.ws.wadl
org.devnull
org.eclipse.jst.server.generic
org.glassfish.api
org.thymeleaf
org.ujorm
org.sakaiproject.sitestats
net.java.dev.stax-utils
org.jwat
com.github.sstone
org.objectweb.fractal.bf.binjiu.description
com.google.code.narcissus-webtests
com.github.cwilper.fcrepo-misc
org.jdesktop
com.cedarsoft.business
org.codehaus
org.eclipse.mylyn.monitor
org.sakaiproject.jsf
httpcomponents-httpcore
com.netflix.netflix-commons
org.coconut.internal
net.sf.gnu-hylafax
net.sf.hammockmocks
org.jnario
org.jodah
com.saucelabs.selenium
org.mnode.ical4j
org.jboss.managed.beans
com.nesscomputing.service.discovery
org.apache.ws.xmlschema
org.andromda.repositories
com.googlecode.refit.eg
org.ops4j.pax.wicket
gsbase
org.apache.maven.mae
org.codehaus.mojo.groovy.feature
apache-jaxme
au.csiro
avalon-repository
br.com.arsmachina
ca.pgon
ch.cmbntr
com.54chen
com.atlassian
com.atlassian.confluence.extra
com.atlassian.crucible.plugins
com.atlassian.fecru.plugin.commithook
com.barchart.pivot
com.bazaarvoice.jolt
com.buschmais.jqassistant.core
com.codereligion
com.coherentlogic.fred.client
com.danidemi.jlubricant
com.datasift.dropwizard
com.devbliss.gwtbliss
com.fathzer
com.feedzai.fos
com.ge.snowizard
com.github.athieriot
com.github.crisposs
com.github.frankiesardo
com.github.heuermh.sparkling
com.github.hoary.ffmpeg
com.github.jarlakxen
com.github.jeluard
com.github.jsonld-java
com.github.kzwang
com.github.nicosensei
com.github.play2war
com.github.rholder
com.github.subchen
com.github.t3hnar
com.github.venkatramanm
com.google.code.maven-play-plugin
com.google.code.validationframework
com.google.gerrit
com.googlecode.gwtrpcplus
com.googlecode.japi-checker
com.googlecode.static-ioc
com.indoles.clj
com.io7m.changelog
com.io7m.jstructural
com.marvinlabs
com.microsoft.reef
com.mysema.maven
com.neovisionaries
com.nulab-inc
com.oracle.tools
com.osinka
com.outr.net
com.ovea.tajin.framework
com.palominolabs.salesforce
com.peterphi.std.guice
com.scalarx
com.scalatags
com.senseidb
com.singhinderjeet
com.softwaremill.macwire
com.springsource.insight.plugins
com.ursaj.hfs
com.wix
com.yakaz.elasticsearch.plugins
de.mhus.osgi.tutorial
de.saxsys.synchronizefx
de.twentyeleven.unitprofiler
excalibur-altrmi
excalibur-instrument
fr.inria.powerapi.example
hu.meza.tools
hudson.plugins
io.airlift.airship
io.tracee.examples
it.tidalwave.superpom
jboss.jbossts
li.rudin.arduino
li.rudin.cdi
li.rudin.mv
li.rudin.webdoc
loom
net.adamcin.sshkey
net.codingwell
net.imagej
net.kencochrane.raven
net.kindleit
net.officefloor.example
net.sf.cuf
net.sf.exlp
net.sf.javaprinciples.membership
net.sf.jmpi
net.sf.squirrel-sql.thirdpary-non-maven
org.99soft.guice.sli4j
org.agiso.tempel
org.apache.activemq.tooling
org.apache.archiva.redback.components
org.apache.cxf.fediz
org.apache.juddi.example
org.apache.karaf.deployer
org.apache.pivot
org.basepom.m2e
org.beangle.data
org.checkerframework
org.codehaus.mojo.chronos-samples
org.commonjava.aprox.wars
org.corejet
org.eclipse.mylar
org.eclipse.virgo.bundlor
org.everit.osgi.dev
org.flywaydb
org.geoserver.maven
org.graylog2
org.gridgain
org.hisrc.jsonix
org.hudsonci.libs
org.inigma.shared
org.jasig.maven
org.jboss.ejb3.embedded
org.jboss.errai.archetypes
org.jboss.portal.core
org.jboss.seam.faces
org.jboss.seam.reports
org.jboss.teiid.documentation
org.jbundle.config
org.jglue.cdi-unit
org.jppf
org.jtransfo
org.kevoree.library.cloud
org.kevoree.modeling
org.keymg
org.kualigan.maven.archetypes
org.modelmapper.extensions
org.mule.tests.archetypes
org.nosceon.datolite
org.nuxeo.ecm.webengine
org.openldap
org.osmdroid
org.ow2.fractal.distribution
org.ow2.shelbie.commands
org.pcap4j
org.richfaces.archetypes
org.richfaces.samples
org.sakaiproject.basiclti
org.scalatra.scalate.tooling
org.scaldi
org.terracotta.toolkit
org.trimou
org.wickedsource.logunit
org.xaloon.core
pl.matisoft
se.javasoft.development
se.skltp.adapterservices.se.apotekensservice
se.skltp.ei
si.urbas
springmodules
ua.mobius.media
org.apache.servicemix.examples.bridge-camel
org.apache.maven.skins
com.github.tony19
org.jscsi
com.supperslonic
com.tchepannou.payment
org.apache.onami.spi
org.fusesource.examples.fabric-camel-dosgi
org.fusesource.fabric.fabric-examples.fabric-camel-dosgi
org.glassfish.main.jdbc.jdbc-ra
org.mule.modules.jca
no.tornado.databinding
org.textmapper
net.sourceforge.reqtracer
org.ow2.fractal.bf.binjiu.description
com.linkedin.sensei
org.mobicents.media.io
net.sf.buildbox.strictlogging
org.jboss.xnio
net.lucubrators
org.fusesource.hawtdispatch
org.anadix
org.coconut.core
com.github.sworisbreathing.sfmf4j
org.fusesource.bai
org.fuin
com.ovea.tajin.server
com.infinitumframework
ru.yandex.qatools.htmlelements
com.linkedin.zoie
directory-asn1
com.rackspacecloud
net.sourceforge.kivu4j.job
org.ow2.jonas.agent
edu.vt.middleware
com.seitenbau.testing
org.ow2.util.protocol
com.sun.commons
org.glassfish.main.jdbc
com.pogofish.jadt
javax.servlet.jsp.jstl
com.googlecode.libphonenumber
org.jboss.remoting
org.ow2.jasmine.drools
org.jlibrary
org.jbox2d
regexp
hivemind
org.appspy.perf
org.hudsonci.tools
jakarta-regexp
org.scribe
org.scala-lang-osgi
net.sf.derquinsej
org.ow2.petals.wsstar.oasis-ws-basenotification
org.omnaest.i18nbinder
org.xj4
org.commonjava.maven.atlas
org.eclipse.wst.sse
com.jolbox
relaxngDatatype
org.jgrapht
org.jgroups
org.apache.servicemix.kernel
fr.smallcrew.foundation
org.eclipse.gmf.runtime.common.ui
org.javolution
sshtools
com.splout.db
org.jgrasstools
org.jomc.sequences
org.atemsource
de.akquinet.jbosscc
com.projectdarkstar.example.projectsnowman
org.sonatype.nexus.capabilities
com.adobe.blazeds
org.testatoo
com.dhemery.runtime-suite
biz.massive-dynamics
com.zaubersoftware.leviathan
org.ow2.util.maven.osgi
com.codeplex.wsitbt
org.sakaiproject.scheduler
org.siddhi
org.ow2.fractal.julia.osgi
oauth.signpost
org.jboss.classpool
de.ovgu.dke.glue
org.eviline
edu.washington.cs.knowitall.stanford-corenlp
org.ujoframework
com.ovea.tajin.servers
org.apache.karaf.jaas
com.likeness.components
org.sonatype.gshell.ext
javax.websocket
com.googlecode.gwt-test-utils
com.force.api
org.mobicents.media.resources
com.taobao.common
com.lohika.alp
com.googlecode.jace
org.sonatype.security.realms
org.randombits.storage
com.carrotsearch.randomizedtesting
com.beust
org.jdal
com.lmco.shindig
edu.washington.cs.knowitall.clearnlp
javax.xml.rpc
com.elega9t
com.ullink.gradle
it.tidalwave.geo.examples
net.sourceforge.javaocr.plugins
se.digiplant
com.zavakid.commons
com.luzi82.nagatoquery
org.sikuli
se.vgregion.pubsubhubbub
javax.xml.parsers
com.google.javascript
org.apache.sshd
directory-shared
org.glassfish.main.webservices
org.sakaiproject.calendar
org.objectweb.jorm
com.aragost.javahg
org.ow2.jonas.jpaas
net.sourceforge.scenarlang
com.cloudseal.client
org.jbundle.util.osgi.wrapped
org.codehaus.groovy.modules.remote
org.apache.bsf
dtdparser
net.java.dev.vcc
org.sonatype.nexus.client
de.akquinet.chameria
org.appspy.core
de.jiac.micro.extensions
org.apache.rat
com.sirika.httpclienthelpers
net.homeip.yusuke
org.eclipse.jetty.tests
org.soitoolkit.commons.components
org.glassfish.main.orb
com.admc
com.graphaware
com.senseidb.zoie
org.ajoberstar
org.apache.archiva.redback.components.cache
org.cloudbees.sdk.plugins
org.codehaus.httpcache4j
org.codehaus.sonar-plugins.flex
org.codehaus.sonar-plugins.javascript
org.codehaus.sonar-plugins.python
org.eiichiro.acidhouse
org.scaloid
com.carrotgarden.util
com.adaptc.gradle
org.helgoboss
org.unix4j
com.github.podal.async
org.codehaus.fabric3.webapp
com.orange.labs.quickpass
org.opensaml
at.ipsquare
se.vgregion.signer-service
org.codeartisans.swing-on-steroids
org.ow2.weblab.components
torque
org.defne.samples
org.apache.myfaces.extensions.cdi.core
org.apache.karaf.features
org.mod4j.org.eclipse.emf.mwe
org.fictus
xstream
org.apache.opennlp
javaee
org.eclipse.emf.edit
com.rempl.readers
it.tidalwave.bluebook
net.uniscala
org.culturegraph
com.yubico
org.jopendocument
com.strategicgains.repoexpress
net.stickycode.deploy
com.seleniti.ioccommons
uk.co.vurt.hakken
org.andromda.timetracker
org.cogroo.lang.pt_br
org.nuiton.processor
org.apfloat
org.jboss.profileservice
fr.inria.powerapi.processor
it.tidalwave.betterbeansbinding
com.thoughtworks.qdox
ant-contrib
org.apache.myfaces.orchestra
net.java.sezpoz
de.odysseus.staxon
org.jogamp.gluegen
org.imajine
se.vgregion.oppna-program-account-activation
org.glassfish.main.registration
com.sun.jersey.oauth
org.ijsberg
org.jboss.arquillian.config
org.apache.neethi
org.jbundle.util.wsdl
org.eclipse.emf.validation
org.jboss.arquillian.testng
avalon-phoenix
org.eclipse.jst.server
directory
org.jboss.jpa
org.jboss.remoting3
org.geolatte
org.eclipse.jet
redis.clients
com.sun
org.eclipse.rap
com.godmonth
org.uimafit
net.sqlind
org.jenkins-ci.main
foxtrot
org.firebirdsql.jdbc
dnsjava
org.ocpsoft.prettytime
org.sakaiproject.profile2
com.alexkasko.springjdbc
fr.norsys.asoape
org.sonatype.buup
javax.jbi
org.jomc.sdk
org.objectweb.perseus
se.gothiaforum.gothia_actors
net.tirasa.hct
org.apache.karaf.tooling
org.ow2.frascati.native
com.squeakysand.jsp
org.syncope
org.picketlink.distribution
javax.enterprise.deploy
org.objectweb.howl
org.meruvian.yama
org.jdtaus.core.logging
org.hectorclient
org.codehaus.cake.internal
org.codehaus.btm
jtidy
com.nesscomputing.testing
org.ow2.frascati.intent
net.iharder
org.fishwife
com.pyx4j
org.jboss.threads
au.net.causal.projo
avalon-meta
ch.rasc
com.3pillarglobal.labs
com.airhacks
com.alexvasilkov
com.arcbees
com.astamuse
com.atlassian.amps
com.atlassian.browsers
com.atlassian.confluence.officeconnector
com.atlassian.fisheye
com.atlassian.instrumentation
com.atlassian.plugin.automation
com.atlassian.plugins.test
com.atlassian.stash.plugin
com.atlassian.webhooks
com.automatak.lib4s
com.bizo
com.byteground
com.cedarsoft.annotations
com.cedarsoft.serialization.samples
com.code-troopers
com.connect-group
com.crawljax.plugins
com.danhaywood.isis.domainservice
com.escalatesoft.subcut
com.geeoz.atom
com.gfk.senbot
com.github.ansell.oas
com.github.dakusui
com.github.davidcarboni
com.github.ferstl
com.github.h0ru5.gwt
com.github.hermod
com.github.jinahya
com.github.junitrunner
com.github.scullxbones
com.github.seanparsons.jsonar
com.github.tntim96
com.goodow.realtime
com.google.appengine.archetypes
com.google.code.play2-maven-plugin
com.googlecode.ibaguice.cache
com.guokr
com.h3xstream.findsecbugs
com.headius
com.igormaznitsa
com.java-adventures.smarkdown
com.javax0
com.kirgor.enklib
com.kncept.httpserver
com.livestream
com.mapzen.android
com.marvinformatics.formatter
com.microsoft.tang
com.nefariouszhen.trie
com.netbout.spi
com.netflix.ribbon
com.netflix.suro
com.ning.billing.plugin
com.orrsella
com.osinka.camel
com.osinka.subset
com.outr.query
com.proofpoint.event
com.quantifind
com.rockymadden.stringmetric
com.sap.prd.mobile.ios.mios
com.savoirtech.hecate
com.sixdimensions.wcm.cq
com.spotify
com.squareup.rack
com.squareup.spoon
com.stackify
com.stanfy.enroscar
com.strategicgains.archetype
com.sun.mep
com.syncthemall
com.tojc.ormlite.android
com.tqlab.sense
com.tunnelvisionlabs
com.tuplejump
com.vast
com.vaushell
com.vectorprint
com.vektorsoft.demux.desktop
com.vektorsoft.demux.tools
com.vilt-group.minium
com.weiglewilczek.scala-lang-osgi
com.wordnik.swagger
com.yammer.tenacity
com.zaxxer
de.cubeisland.engine
de.dailab
de.devland.esperandro
de.flapdoodle.wicket
de.flapdoodle.wicket6
de.greenrobot
de.grundid.osmtools
de.holisticon.util.tracee.backend
de.holisticon.util.tracee.inbound
de.lgohlke.mojo
de.ruedigermoeller
de.xwic.cube
dna
edu.gatech.gtri.typesafeconfig-extensions
edu.uiuc.ncsa.security.delegation
edu.upenn.psych.memory
exteca
fi.reaktor
freebxml
info.freelibrary
info.schleichardt
io.bigio
io.ifar.skid-road
io.joynr.java.backend-services
io.joynr.java.messaging.bounceproxy
io.motown.ocpp
io.prediction
io.shaka
io.tracee.backend
io.tracee.inbound
jboss.aop
jboss.jbossas.core-libs
jp.co.nohana
merlin
metaclass
muse
net.awired.parent
net.customware.license
net.disy.wps
net.eusashead.parquet
net.fortytwo.rdfagents
net.hamnaberg.rest
net.officefloor.core
net.officefloor.maven
net.onedaybeard.agrotera
net.openhft
net.recommenders.rival
net.scalaleafs
net.sf.alchim
net.sf.corn
net.sf.extjwnl
net.sf.javaprinciples.client
net.sf.jnrpe
net.sf.jped.plugins
net.sf.matrixjavalib
net.sourceforge.ctakesresources
net.sourceforge.purrpackage
net.sourceforge.testxng
net.thucydides.plugins.jira
no.tornado
nz.ac.auckland.lmz.javascript
org.aerysoft.miniauth
org.agiso.core
org.androidtransfuse
org.apache.empire-db
org.apache.flume.flume-ng-sinks
org.apache.geronimo.genesis
org.apache.hive.shims
org.apache.jclouds.chef
org.apache.jclouds.cli
org.apache.karaf.cave.server
org.apache.marmotta.webjars
org.apache.myfaces.extensions.cdi.test
org.apache.phoenix
org.apache.portals.applications
org.apache.servicemix.activemq
org.apache.servicemix.samples.loan-broker
org.apache.taglibs
org.apache.tuscany.maven.plugins
org.apache.vxquery
org.b3log
org.beangle.ems
org.brianmckenna
org.cloudgraph
org.codehaus.httpcache4j.storage
org.codehaus.jremoting
org.cruxframework.plugin
org.dihedron.commons
org.easycluster
org.gatein.shindig
org.giavacms.common
org.hibersap
org.http4s
org.ict4h
org.improving
org.iplantc.core
org.jabsaw
org.jamel.kladr
org.japura
org.jasig.mojo.jspc
org.jboss.archetype.wfk
org.jboss.ejb3.singleton
org.jboss.seam.jcr
org.jboss.seam.security
org.jboss.soa.bpel.runtime
org.jboss.weld.archetypes
org.jsonschema2pojo
org.jsr107.ri
org.kuali.student.api
org.kuali.student.web
org.lumongo
org.metawidget.modules.swing
org.mobicents.resources.diameter
org.mobicents.servers.diameter.examples
org.mobicents.servlet.sip.arquillian.showcase
org.nbn-resolving
org.nuiton.web
org.ode4j
org.openbp
org.opencastproject
org.openengsb.infrastructure
org.opengis.cite
org.openl.rules.demo
org.ops4j.pax.construct
org.ops4j.pax.wicket.samples.blueprint
org.orbroker
org.osgl
org.primefaces.extensions
org.pustefixframework.samples.modules
org.qooxdoo
org.randombits.confluence
org.restdoc
org.rhq.metrics
org.rzo.yajsw
org.safehaus.chop
org.scribble.bundles
org.shredzone.commons
org.smartparam.manager
org.spark-project.akka
org.sqlproc
org.stuartgunter
org.synchronoss.cpo
org.t3as
org.talend.esb.hyperic
org.teknux
org.thymeleaf.extras
org.vibur
org.wiztools
org.xaloon.plugins
ro.fortsoft.wicket.dashboard.widgets
se.natusoft.tools.doc.markdowndoc
se.radley
se.skltp.adapterservices.crm.carelisting
se.vgregion.iFeed
uk.co.modular-it
net.rumati.logging
org.sourceprojects.lycia
org.nakedosgi
ch.qos.mistletoe
com.tinesoft
net.ggtools.maven
net.java.dev.jgoodies
org.apache.servicemix.examples.cxf-wsdl-first
de.agilecoders.wicket.webjars
org.andromda.thirdparty.jmi
net.disy.jquery
net.java.dev.fuse
org.ow2.chameleon.urlshortener
org.ow2.petals.tools.rmi
biz.aQute.bnd
com.github.tlrx
net.java
com.jamesmurty.utils
org.eclipse.jst.jsf
org.jbundle.config.web
com.googlecode.pojosr
colt
org.ow2.easybeans.examples.maven.ear
org.sonatype.maven.archetype
org.jboss.spec.javax.faces
org.eclipse.wst.ws
org.gcontracts
org.jasig.resource-aggregator
org.jboss.cl
org.httpobjects
com.orbitz.erma
com.google.zxing
org.apache.servicemix.kernel.testing
net.sourceforge.stripes
com.catify.bpmn
checkstyle
org.eclipse.jst.ws
org.pojava
org.apache.isis.runtimes.dflt.bytecode
ch.tatool
org.jvnet.com4j
javax.annotation
velocity-tools
org.eclipse.mylyn.tasks
org.codehaus.sonar-plugins.cxx
org.duracloud
org.ow2.jasmine.design
org.objectweb.fractal.fraclet
emma
com.google.caliper
org.eclipse.emf.codegen
com.google.code.eforceconfig
org.apache.servicemix.kernel.jaas
ch.qos.cal10n
org.fusesource.hawtbuf
org.eclipse.gmf.runtime.common.ui.services
com.rempl.readers.its
org.fusesource.scalate.sbt
org.jboss.as.metadata
org.glassfish.websocket
org.jdtaus.sequences
org.eclipse.gmf.runtime.diagram
org.twdata.maven
de.jiac.micro
org.eclipse.team.cvs
org.glassfish.tests
org.eweb4j
com.mycila.testing
de.javakaffee
org.openxri
org.apache.ibatis
org.andromda.thirdparty.netbeans.mdr
net.stickycode.resource
org.jenkins-ci
com.github.shyiko.jsst
pmd
fr.javafreelance.fluentlenium
de.schlichtherle.truelicense
classworlds
org.quattor.pan
org.eclipse.swt.gtk.linux
org.glassfish.main.elasticity
org.sindice.siren
it.uniroma2.art.owlart
net.stickycode.component
jencks
org.codehaus.cake.service
net.java.dev
commons-attributes
org.weakref
org.richfaces.framework
com.sun.jersey.contribs.jersey-oauth
org.codehaus.groovy.maven.support
org.codehaus.sonar-ide
me.prettyprint
org.eclipse.swt.win32.win32
se.skltp.agp
portlet-api
net.sourceforge.tink
org.mobicents.ha.javax.sip
com.fortuityframework
org.apache.aries.quiesce
org.mod4j.org.eclipse.xtext
org.apache.myfaces.core.internal
se.vgregion.webbisar
org.w3c.css
org.eclipse.gmf.runtime.emf
org.apache.maven.indexer
com.googlecode.q-link
jstl
org.mobicents.protocols.ss7.m3ua
org.eclipse.equinox.http
org.mobicents.protocols.ss7.sccp
org.livetribe
org.mobicents.protocols.ss7.hardware
com.fasterxml.jackson
org.jmockring
org.apache.geronimo.plugins.monitoring
com.github.johanneslichtenberger.sirix
com.nummulus
org.apache.onami
org.fusesource.hawtjni
org.gwtopenmaps.openlayers
org.sonatype.gshell.dist
com.sematext.ag
com.dlecan.reflections
com.flotype.bridge
com.googlecode.windowlicker
eu.cedarsoft.wicket
org.jboss.tattletale
com.google.code.maven-play-plugin.org.allcolor.shanidom
org.jboss.interceptor
org.lambico
ring
org.sonatype.nexus.plugins.ldap
com.tinkerpop.gremlin
com.github.mcpat.gcf
javax.security.auth.message
net.peachjean.guice
org.codehaus.fabric3.development
org.semispace.comet
org.xins
org.glassfish.webservices
com.lexicalscope.jewelcli
org.jsmiparser
org.directwebremoting
com.lodgon.dalicore
net.sf.jxls
org.openengsb.labs.paxexam.karaf
org.jboss.seam.conversation
org.apache.maven.enforcer
org.sonatype.jsecurity
org.jdtaus.correspondents
org.mod4j.org.eclipse.core.databinding
com.google.code.javaparser
org.ow2.chameleon.rose
org.jvnet.jaxbhelp
org.eclipse.emf.codegen.ecore
edu.ucla.sspace
se.fishtank
com.tacitknowledge.flip
org.objectweb.fractal.bf.hdl
dumbster
net.sf.jtidy
com.dbdeploy
com.twelvemonkeys
org.adorsys.xlseasy
org.rometools
org.dspace.dependencies
net.stepniak
org.eclipselabs.osgi-http-service-utils
org.eclipse.mylyn.context
net.java.dev.weblets
org.sakaiproject.msgcntr
com.mogwee
org.nuiton.jpa
org.jcoderz.fawkez
org.jboss.maven.surefire.modular
org.fuzzydb.attrs
se.vgregion.mobile
qdox
org.ow2.petals.wsstar.oasis-ws-resource
org.ow2.petals.wsstar.oasis-ws-resourceproperties
org.eclipse.emf.query
org.roboguice
tranql
org.jboss.spec.javax.interceptor
de.eonas.portal
org.codehaus.fitnesse-web
org.semantictools
ro.fortsoft.ff2j
ro.fortsoft.log2j
se.vgregion.oppna-program-hsatools-mobile-webservice
org.postgis
com.ctp.cdi.query
org.ow2.petals.wsstar.oasis-ws-resourcelifetime
com.nesscomputing
eu.eu-emi
org.jboss.forge.test
io.airlift.resolver
org.codehaus.mojo.jspc
com.perforce
nsuml
org.glassfish.appclient
org.coconut.event
biz.neustar
net.stickycode.bootstrap
org.glassfish.registration
com.sdicons.jsontools
javanettasks
org.glassfish.jersey.core
net.adamcin.recap
org.apache.geronimo.daytrader
org.ops4j.peaberry.extensions
com.android.tools.lint
com.bazaarvoice.commons.data
com.github.mheath
com.github.neothemachine
com.github.taksan
com.owlplatform
name.pehl
org.apache.myfaces.trinidad
org.jboss.arquillian.example
de.itsvs
org.objectweb.petals.tools.rmi
org.jboss.spec.javax.xml.rpc
org.glassfish.main.appclient
org.sonatype.mercury
org.kuali.maven.impex
commons-math
no.antares
org.jboss.aspects
de.novanic.gwteventservice
org.objectweb.fractal.fraclet.annotation
net.java.dev.webdav
net.ftlines.metagen
org.ow2.proactive
net.sf.jopt-simple
org.tmatesoft.sqljet
net.sourceforge.jtds
org.sonatype.jline
ojb
org.hisrc.hifaces20
org.synyx.hades
com.github.github
org.jaccept
org.apache.db.torque
com.kupal.commons
servletapi
org.apache.james.hupa
cas
org.reco4j
org.opensymphony.quartz
org.jboss.seam.embedded
org.sakaiproject.courier
com.marvinformatics
com.sparkjava
org.mixer2
org.synyx.hera
net.arnx
org.syncope.identityconnectors
com.google.gwt.google-apis
com.opencloud
org.jenkins-ci.lib.dtkit
com.meschbach.cise
org.jboss.spec.javax.el
com.github.wokier
com.google.code
com.synhaptein
net.contextfw
org.veripacks
it.tidalwave.steelblue
org.ow2.jonas.jpaas.system-representation
org.eclipse.emf.ecore.sdo
org.mobicents
org.openengsb.labs.jpatest
com.jfinal
org.baessie
com.googlecode.gwtupload
com.googlecode.matrix-toolkits-java
com.webguys.ponzu
org.freecompany.util
com.barchart.udt
org.ow2.novabpm
org.kubek2k
net.sourceforge.dynamicreports
org.springframework.android
net.md-5
com.innoq.liqid
org.andromda.bootstrap.repositories
com.mtvnet.boxspring.modules
com.vaadin.addon
net.phaedra
org.apache.flume.flume-ng-channels
org.glassfish.main.loadbalancer
org.jasig.portlet.courses
org.sakaiproject.assignment
org.coosproject.api
com.tinkerpop.rexster
org.amplecode
xmldb
org.sakaiproject.mailarchive
berkeleydb
org.apache.geronimo.schema
org.apache.aries.subsystem
org.jboss.injection
org.ops4j.pax.wicket.samples.view
de.codecentric
org.getlantern
org.glassfish.main.appclient.client
org.vraptor
org.webbitserver
org.geotoolkit.project
com.bsb.common.vaadin
org.jboss.osgi.http
org.jboss.osgi.jmx
com.mangofactory
net.javacrumbs.json-unit
org.jdtaus.core.container
org.fusesource.fabric.fab
org.subethamail
jboss.jbossws
org.jboss.spec.javax.annotation
org.coconut.test
org.apache.myfaces.test
br.gov.frameworkdemoiselle.component
br.usp.each.saeg
ca.grimoire.jnoise
ca.innovativemedicine
cargo
cc.concurrent
cc.redberry
ch.uzh.ifi.ddis.ifp
com.alexkasko.krakatau
com.almende.eve
com.android.tools
com.atlassian.bonfire
com.atlassian.crucible
com.atlassian.notifier
com.atlassian.ofbiz
com.atlassian.sdk
com.bacoder.parser
com.bazaarvoice.curator
com.bazaarvoice.dropwizard
com.belladati
com.bloidonia
com.bluetrainsoftware.maven
com.bring
com.btmatthews.maven.plugins
com.cathive.fx
com.cedarsoft.couchdb
com.cedarsoft.serialization.generator
com.cedarsoftware
com.cloudbees.cloud_resource
com.cognifide.slice-addon
com.coherentlogic.wb.client
com.confluex
com.couchace
com.cybercom.logging
com.dividezero
com.dyuproject.protostuff.archetype
com.ebuddy.cassandra
com.eriwen
com.esyfur
com.facebook.hiveio
com.facebook.nifty
com.firebase
com.flyobjectspace
com.fmpwizard
com.foundationdb
com.ganshane.lichen
com.geishatokyo.jetty
com.gensler
com.gestalt.jbi.components.common
com.geteventstore
com.gilt.jdbi-scala
com.github.akiellor.jasmine
com.github.aloiscochard
com.github.autermann
com.github.ben-manes
com.github.beothorn
com.github.bjoern2
com.github.cjmx
com.github.danielpacak.osgi.swingconsole
com.github.davidmoten
com.github.detro
com.github.eirslett
com.github.hamsterksu
com.github.inspektr
com.github.jodersky
com.github.joschi
com.github.keithyokoma
com.github.levkhomich
com.github.lltyk
com.github.loicoudot.java4cpp
com.github.lucapino
com.github.mauricio
com.github.menacher
com.github.parboiled1
com.github.play2war.ext
com.github.seratch.reaktor
com.github.timurstrekalov
com.github.usc
com.github.wiselenium
com.github.wookietreiber
com.goldmansachs
com.googlecode.princeton-java-introduction
com.googlecode.web-commons
com.graphhopper
com.greenbird.mule
com.guigarage
com.inkapplications
com.jexbox.connector
com.jillesvangurp
com.joanzapata.android
com.jporm
com.jramoyo
com.kaaprotech
com.madgag.scala-git
com.madgag.spongycastle
com.mattwhipple.sproogle
com.mindscapehq
com.moparisthebest.jbgjob
com.msopentech.odatajclient
com.n3twork.storm
com.netflix.fabricator
com.netflix.genie
com.netflix.priam
com.netflix.zuul
com.newrelic.agent.android
com.nikedlab
com.oakfusion
com.palominolabs.jersey
com.pavelvlasov
com.pholser
com.prezi.gradle.pride
com.projectdarkstar.tools.build
com.quigley
com.rultor
com.sap.cloud
com.silanis.esl
com.sourceclear.headlines
com.squareup.wire
com.stc.jmsjca
com.stratio.meta
com.stripe
com.sun.jersey.archetypes
com.sun.tools.btrace
com.sun.xml
com.sun.xml.security
com.tavianator.sangria
com.timesprint
com.tinkerpop.rexster.rexster-kibbles
com.tlorrain.android.rezenerator
com.tomtorsneyweir
com.twelvemonkeys.common
com.untzuntz.ustack
com.yammer.collections.azure
com.yubico.bitcoin
com.zaubersoftware
com.zenjava
de.agilecoders.elasticsearch.logger
de.akquinet.javascript.archetypes
de.androbit
de.felixschulze.gradle
de.holisticon.util.tracee.examples
de.kandid
de.matrixweb.osgi.wrapped
de.tudarmstadt.ukp.dkpro.bigdata
edu.uiuc.ncsa.security
edu.washington.cs.knowitall.srlie
eu.fakod
eu.inn
eu.interedition
eu.limetri.api
eu.trentorise.opendata
eu.vitaliy
excalibur-datasource
excalibur-pool
excalibur-thread
external.atlassian.jgitflow
fm.last
fr.dudie
fr.norad.jaxrs.doc
fr.xebia.extras
fr.ybonnel
fr.zebasto
hu.kazocsaba
info.magnolia.ui
io.backchat.hookup
io.escalante
io.fabric8.examples.fabric-camel-dosgi
io.fabric8.mq
io.fabric8.patch
io.github.benas.cb4j
io.github.cloudify
io.joynr.examples
io.motown.domain
io.prometheus.client.examples
it.cnr.isti.domoware.tinyos
it.unitn.disi
jen
jp.furyu
li.rudin.jooq
merlin-tutorial
middlegen
net.adamcin
net.avh4.framework
net.code-story
net.csdn
net.davidbuccola.force-spa
net.dempsy
net.eusashead.hateoas
net.fehmicansaglam
net.hasor
net.jadler
net.javacrumbs.future-converter
net.jodah
net.ju-n.maven.plugins
net.ju-n.maven.skins
net.oneandone.maven.plugins
net.sf.atmodem4j
net.sf.cssbox
net.sf.ehcache.internal
net.sf.ingenme
net.sf.mbus4j
net.sourceforge
net.sourceforge.javawebparts
net.sourceforge.ota-tools.schema.jaxb
net.sourceforge.pldoc
net.stickycode.plugins
net.surguy
net.trajano.mojo
no.digipost
nu.rinu
nz.co.aetheric.maven
nz.net.osnz.jmz
org.akhikhl.mavenize
org.akhikhl.unpuzzle
org.alcibiade
org.andromda.maven.plugins.site
org.apache.any23.plugins
org.apache.cxf.fediz.systests
org.apache.cxf.xjcplugins.tests
org.apache.deltaspike.cdictrl
org.apache.directmemory.server
org.apache.directory.skins
org.apache.felix.karaf.deployer
org.apache.felix.karaf.webconsole
org.apache.geronimo.genesis.config
org.apache.geronimo.genesis.plugins
org.apache.geronimo.samples.javaee6
org.apache.isis.objectstore
org.apache.jclouds.common
org.apache.jclouds.karaf.chef
org.apache.kalumet.controller
org.apache.karaf.diagnostic
org.apache.openejb.itests
org.apache.rave.integration-tests
org.apache.servicemix.samples.bridge
org.apache.sis.core
org.apache.sling.samples
org.apache.tomcat.extras
org.apache.vysper.extensions
org.apache.wink.example
org.apidesign.canvas
org.arquillian.container
org.atmosphere.nettosphere.samples
org.atmosphere.samples
org.axway.grapes
org.bitbucket.cowwoc
org.bitbucket.kienerj
org.bitbucket.mstrobel
org.blueoxygen.cimande
org.bowlerframework
org.brightify.torch
org.bytedeco
org.calrissian.mango
org.camunda.bpm
org.carlspring.maven
org.clojars.runa
org.codehaus.httpcache4j.resolvers
org.codehaus.jet
org.codehaus.sonar-plugins.css
org.codehaus.sonar-plugins.erlang
org.codehaus.sonar-plugins.php
org.codehaus.sonar.archetypes
org.codehaus.sonar.runner
org.commonjava.aprox.launch
org.commonjava.emb.components
org.dihedron.strutlets
org.docx4j
org.eclipse.emf.transaction
org.eclipse.equinox.jmx
org.esupportail
org.fornax.cartridges
org.fusesource.fuse-extra
org.fusesource.mop
org.gatein.management
org.gatein.mop
org.glassfish.jersey.examples.osgi-helloworld-webapp
org.glassfish.jersey.security
org.glassfish.main.osgi-platforms
org.gridvise
org.hammurapi
org.jacpfx
org.jamel.pkg4j
org.javabits.yar
org.jaylib.scala.config
org.jboss.ejb3.effigy
org.jboss.narayana.rts
org.jboss.portletbridge
org.jboss.seam.catch
org.jboss.seam.mail
org.jboss.seam.rest
org.jboss.seam.social
org.jboss.seam.validation
org.jboss.soa.bpel.dependencies.esb
org.jboss.weld.examples
org.jboss.weld.integration
org.jboss.ws.metro
org.jbpm.dashboard
org.jclouds.chef
org.jclouds.karaf.chef
org.jibx.schema.config
org.jsoftware
org.kasource.websocket
org.kevoree.corelibrary.arduino
org.kie.remote
org.knowhowlab.osgi.shell
org.kohsuke.no-more-tears
org.luaj
org.mapdb
org.mattressframework
org.mobicents.examples.converged
org.mybatis.caches
org.neo4j.app
org.nfctools
org.noorm
org.nuxeo.ecm.opensocial
org.objectweb.fractal.bf.itests
org.objectweb.proactive
org.objectweb.proactive.extensions.p2p.structured
org.openengsb.ports
org.openengsb.tooling.archetypes
org.openscoring
org.opensocial.explorer
org.ops4j.pax.wicket.samples.mixed
org.overlord
org.overlord.sramp
org.ow2.chameleon.database
org.ow2.chameleon.fuchsia.exporter
org.ow2.frascati.mojo
org.ow2.frascati.tinfi.osgi
org.ow2.jasmine.kerneos
org.ow2.jonas.tools.maven
org.ow2.kerneos.graniteds-osgi
org.ow2.xlcloud.xms
org.owasp.jbrofuzz
org.patrodyne
org.pidster
org.planet42
org.prevayler.demos
org.projectreactor.spring
org.qsardb
org.qsardb.storage
org.reactivemongo
org.reddwarfserver.tools.build
org.scala-refactoring
org.scommon
org.shredzone.flattr4j
org.smali
org.sonatype.maven.plugin
org.sonatype.maven.plugins
org.springframework.cloud
org.stefanutti.metrics.aspectj
org.teavm
org.technbolts
org.terrameta
org.tresql
org.vesalainen.lpg
org.virtuslab
org.wicketstuff.htmlvalidator
org.wildfly.camel
org.xaloon.wicket
org.xerial.larray
org.zkoss.theme
pl.chilldev.commons
pro.redsoft.iframework
se.skltp.adapterservices.ehr.accesscontrol
tw.edu.sju.ee.eea.jni
tw.hyl.common
ua.mobius.media.resources
uk.ac.diamond
uk.co.javahelp.fitnesse
uk.org.retep
uk.org.retep.microkernel
uk.org.retep.xmpp
us.joshuatreesoftware
us.rothmichaels.lib
com.github.slugify
com.truchsess
org.funcish
org.kevoree.watchdog
org.objectweb.fractal.juliac.petals
org.ocpsoft.logging
uk.gov.nationalarchives.thirdparty.netbeans
com.cedarsoft.spring
com.googlecode.sarasvati.thirdparty.netbeans
com.jfolson
com.weiglewilczek.scalamodules
net.micwin.ticino
net.sf.itcb.module.blank
net.sourceforge.fiftyone-java
net.thucydides.maven.plugins
org.apache.geronimo.samples.osgi.showmethemoney
org.apache.servicemix.examples.wsdl-first
org.cloudfoundry
org.hisrc.juneloop
org.jdto
org.kohsuke.scotland
org.ow2.orchestra.installer.izpack
org.ow2.util.event
org.sakaiproject.lessonbuilder
uk.bl.wa.warc-explorer
au.net.ocean.maven.plugin
org.apache.myfaces.extensions.cdi.modules.alternative
org.jbundle.util.biorhythm
ant4eclipse
com.opensymphony
com.jayway.awaitility
com.tchepannou.util
com.googlecode.jslint4java
org.sonatype.sisu.litmus
com.thimbleware.jmemcached
org.jvnet.localizer
org.sakaiproject.taggable
org.ow2.petals.registry
org.extrema-sistemas.loom
ru.frostman.web
org.apache.aries.samples.blueprint.idverifier
org.mobicents.protocols.ss7.map
sun-jaxb
org.bluestemsoftware.specification.eoa
org.ow2.chameleon.json
org.bluestemsoftware.specification.eoa.ext
org.sakaiproject.edu-services.course-management
org.jencks
javancss
org.mod4j.org.eclipse.ui
displaytag
fi.evident.cissa
com.peterlavalle.libgdx
de.suur.jarmi
org.kualigan.liquibase
com.cedarsoft.commons.history
org.concordion
com.jamonapi
net.sourceforge.jtransforms
org.etourdot
com.github.stephenc.high-scale-lib
org.apache.isis.runtimes.dflt.profilestores
org.objectweb.fractal.fractalrmi
net.sf.sfac
net.java.quickcheck
bsf
org.deri.xsparql
com.sun.xml.txw2
jalopy
biz.littlej.jreqs
com.github.vadims
org.andromda.taglibs
org.restlet.gwt
org.bsc.bean
eu.appsatori
org.codehaus.cake.cache
no.uis.fsws
com.cedarsoft.db
javax.management.j2ee
org.eclipse.uml2.uml
org.jdbi
org.jboss.forge.furnace.test
izpack
com.pivotallabs
org.kasource.kaspring
jgraph
org.glassfish.ejb
com.apple
bcel
com.squeakysand.jcr
org.codehaus.sonar-plugins.jmeter
de.odysseus.juel
com.bazaarvoice.snitch
com.ovea.tajin
nl.orange11.healthcheck
org.sourceprojects.xmlparser
org.glassfish.orb
net.java.dev.javacc
org.apache.felix.karaf.features
org.jfrog.maven.annomojo
org.logicblaze.lingo
net.rootdev
org.xsocket
net.sf.jasperreports
org.jboss.naming
org.jboss.aesh
de.matrixweb.osgi
se.vgregion.medcontrol
com.chenlb.mmseg4j
net.sf.csutils
org.jinterop
org.xlightweb
com.pelzer.util
org.99soft.shs
org.jdtaus.core.monitor
org.functionaljava
org.jvnet.maven-jellydoc-plugin
es.weso
org.glassfish.jms
org.owasp.antisamy
com.bluetrainsoftware.composite
org.jboss.jbossts.jts
se.vgregion.signer-service.reference-application
net.java.dev.glazedlists
org.xerial.snappy
com.googlecode.gwt-usefull-logging
lt.marsrutai
net.kriomant.buketan
com.squeakysand.osgi
de.jiac.micro.tools
org.mobicents.protocols.stream
org.selunit
net.sf.dtddoc
com.javaforge.scriptella
dk.apaq.crud
org.fuzzydb.atom
net.schmizz
org.eclipse.jst.common.annotations
org.snmp4j
de.jflex
org.java-sql-generator
com.rempl.readers.scm
net.sf.apt-jelly
org.mobicents.protocols.ss7.mtp
com.cedarsoft.commons.db
xml-security
org.jasig.cas3.extensions
org.sakaiproject.presence
com.rogiel.httpchannel
com.github.erd
com.googlecode.aaw.badgerfish
com.googlecode.sarasvati
com.googlecode.wicket-continuous-calendar
com.sidewayscoding
com.trilead
it.assist.jrecordbind
net.stickycode.deploy.sample
net.vidageek
org.glassfish.virtualization
org.jvnet.jax-ws-commons.spring
org.ops4j.pax.tipi
org.tcrawley
se.softhouse
se.vgregion.rss-client
com.cedarsoft.commons.rest
org.coconut.forkjoin
org.jboss.spec.javax.security.jacc
org.dbmaintain
de.schlichtherle
org.skife.config
com.smith9.simply
org.mobicents.protocols.ss7.tools.simulator
org.jboss.spec.javax.resource
org.ow2.jonas.jpaas.vm-configurator.providers
com.jayway.forest
org.eclipse.mylyn.web
com.googlecode.guice-junit4
org.ow2.orchestra.designer
org.openrdf
au.net.ocean.security.auth.gss
org.jbundle.util.jcalendarbutton
net.sourceforge.serp
org.sakaiproject.edu-services.gradebook
com.cloudcontrolled
org.prevayler.spikes
org.jboss.spec.javax.jms
fr.inria.powerapi.reporter
org.jboss.osgi.spi
com.alexgilleran
org.op4j
org.objectweb.fractal.fractaljmx
org.jboss.seam.solder
org.apache.felix.karaf.jaas
net.sourceforge.wurfl
net.sf.cotta.asserts
com.wadpam
org.apache.karaf.tooling.exam
com.kelveden.rastajax
org.sonatype.cert-support
com.sun.mojarra
tanukisoft
org.iq80.leveldb
com.googlecode.gwtquery
com.plausiblelabs.warwizard
com.alibaba.citrus
org.gatein.common
org.ow2.util.archive
ca.uhn.ws
de.ovgu.dke.mocca
net.vz.mongodb.jackson
org.livetribe.slp
co.jirm
com.zanox.lib.rabbiteasy
org.kuali.maven.common
com.sparsity
com.j256.ormlite
se.vgregion.oppna-program-account-management
com.sun.facelets
org.ow2.jonas.launchers
org.eiichiro.jaguar
org.opf-labs.planets
org.springframework.amqp
org.jboss.web
com.vityuk
net.sf.wsag4j.rest
org.httpobjects.jetty
com.cedarsoft.commons.legacy
com.cedarsoft.utils.legacy
com.github.rickyclarkson
com.googlecode.mad-mvntools
com.googlecode.reflective
com.mattbertolini
com.wealdtech
de.codescape.bitvunit
jp.skypencil
org.chorusbdd
org.eclipse.xsd.ecore
org.omnifaces
org.ow2.easybeans.itests
pl.project13.janbanery
se.romanredz.mouse
se.somath.publisher
fm.last.commons
org.apache.maven.mae.components
mockit
com.googlecode.juniversalchardet
com.linkedin.bobo
commons-el
org.ow2.orchestra.eclipse.osgi
net.java.dev.rome
com.google.code.facebookapi
org.uncommons.maths
com.thaiopensource
org.apache.archiva.redback.components.registry
org.andromda.andromdapp.projects
com.googlecode.struts2-conversation
de.berlios.jsunit
org.apache.felix.karaf.admin
org.javafunk.funk
org.eclipse.jst.j2ee.ejb.annotations
com.celum
org.scalatra.socketio-java
com.thoughtworks.proxytoys
org.mobicents.protocols.sctp
org.jboss.osgi.vfs
org.objectweb.util.misc
org.jvnet.libpam4j
org.eclipse.mylyn.bugzilla
com.rubiconproject.oss
org.ztemplates
org.eclipse.gmf.runtime.emf.commands
org.jboss.wise
com.browseengine.bobo
com.github.croesch
com.holmos
com.jolira.enzian
com.orange.labs.quickpass.tm
fi.gekkio.drumfish
org.bitbucket.bradleysmithllc.etl-agent
org.jentity
org.seleniumhq.selenium.grid
org.sonatype.plugins.it.applifecycle
nl.trifork.healthcheck
org.ops4j.orient
org.codehaus.redback.components.registry
de.undercouch
org.eclipse.emf.importer
org.connid.bundles.db
com.tourgeek.thin.app
com.tourapp.thin.app
com.github.cukespace
com.googlecode.jmockit
org.kuali.student.security
smartrics.restfixture
tl.lin
org.jasig.springframework
org.coosproject.messaging.org.apache.xmlbeans
org.mindrot
com.zaubersoftware.commons.auth
com.googlecode.netlib-java
javax.slee
com.cedarsoft.utils.history
net.sf.jazzy
org.objectweb.apollon
org.lazydog.repository
com.github.inti-net
com.keyholesoftware
de.dnb
org.apache.karaf.admin
org.apache.servicemix.geronimo
org.jboss.maven.plugins.jbossas
org.jboss.narayana.arjunacore
org.nosceon.connellite
ca.grimoire.maven
com.dongxiguo.zero-log
com.github.weblets
org.codehaus.plexus.webdav
io.tesla.maven.plugin
org.eclipse.gmf.runtime.emf.type
net.sf.supercsv
net.sf.oval
org.floggy.3rd.org.eclipse.core
edu.washington.cs.knowitall.common-scala
org.sakaiproject.profile
org.objectweb.clif
com.flipthebird.gwt-hashcode-equals
org.glassfish.main.admingui.connector
it.unimi.di
net.alchim31.maven
org.jboss.cdi.tck
org.talend.esb.locator.service
org.sakaiproject.announcement
br.eti.kinoshita
jdepend
net.sf.qualitycheck
com.dhemery
org.codeartisans.asadmin
com.github.trentonadams
de.agilecoders.wicket.mustache
io.buji
org.coffeebreaks.yui
org.knowhowlab.osgi.testing.it
org.tap4j
org.commonjava.couch.web
org.codehaus.gpars
org.jboss.sasl
xmlpull
org.apache.excalibur.component
eu.cedarsoft.utils.history
com.github.fommil
org.jukito
com.backtype
com.zaubersoftware.gnip4j
fr.inria.powerapi.example.adamdemo
org.gridkit.coherence-search
edu.internet2.middleware
org.eclipse.core.resources
com.github.rtyley
com.restfb
com.projectdarkstar.ext.org.lwjgl
com.github.nikita-volkov
com.google.jstestdriver
com.yourmediashelf.fedora.client
ma.glasnost.orika
net.unicon.cas
se.vgregion.healthcare-context
com.wealdtech.hawk
com.xebialabs.overthere
org.andromda.bootstrap.metafacades
org.jboss.ejb3.ejbref.resolver
org.ow2.jasmine.drools.manager
com.zavakid.citrus.tool
org.apache.whirr.karaf
org.kathrynhuxtable.maven.plugins
statcvs
de.jiac.micro.platforms.cdc
org.sonatype.nexus.ant
org.pojomatic
com.sonyericsson.hudson.plugins.gerrit
org.openengsb
org.sonatype.sisu.assembler
se.vgregion.cs-iframe
org.jboss.ejb3.instantiator
com.zaubersoftware.commons.persistence
org.polyglotted
org.qianalyze
de.joerghoh.cq5.healthcheck
org.andromda.bootstrap.translationlibraries
org.lesscss
com.netflix.eureka
org.apache.aries.samples.twitter
org.sakaiproject.mailsender
org.scalala
radeox
net.sf.r4h
org.mutabilitydetector
stax-utils
com.datastax.cassandra
com.fasterxml.util
net.sf.sidaof
org.apache.servicemix.cxf
org.sonatype.appcontext
org.sakaiproject.polls
org.mule.patterns
org.nuiton.jredmine
com.wadpam.opencomponents
org.jboss.spec.javax.servlet.jsp
org.jboss.ejb3.timeout
org.jboss.ejb3.tx2
org.jboss.seam.transaction
swarmcache
andromda
at.logic
avalon-activation
avalon-apps
avalon-composition
be.dnsbelgium
be.eliwan
biz.paluch.visualizr
br.com.ingenieux.cloudy
br.com.prixma
br.com.uol.reconf
br.gov.frameworkdemoiselle.archetypes
cf.janga
ch.rotscher.maven.plugins
ch.softappeal.yass
cl.yaykuy
com.adamldavis
com.alexkasko.delta
com.alexkasko.installer
com.alexkasko.springjdbc.typedqueries
com.anasoft.os
com.andersen-gott
com.ansvia.graph
com.antwerkz.critter
com.applitools
com.atlassian.buildeng.hallelujah
com.atlassian.confluence.plugins.search
com.atlassian.growth
com.atlassian.httpclient
com.atlassian.jira.plugins.webhooks
com.atlassian.jira.tests
com.atlassian.labs.test
com.atlassian.markup
com.atlassian.multitenant
com.atlassian.security
com.atlassian.security.auth.trustedapps
com.atlassian.support
com.atolcd.alfresco
com.bacoder.scm-tools
com.badlogicgames.jglfw
com.barchart.version.tester
com.bastengao.freeroute
com.bazaarvoice.maven.plugins
com.bazaarvoice.ostrich.examples.calculator
com.bazaarvoice.ostrich.examples.dictionary
com.betfair.net.java.opendmk
com.blitline
com.blogspot.mydailyjava
com.bluetrainsoftware.bathe.initializers
com.buschmais.jqassistant
com.carrotgarden.wrap
com.cedarsoft.commons.swing
com.cedarsoft.maven
com.cetsoft
com.chaschev
com.choncms
com.claudiushauptmann
com.cloudbees.clickstack
com.cloudphysics
com.cocosw.accessory
com.coders-kitchen
com.codiform
com.coherentlogic.usaspending.client
com.complexible.stardog
com.cra.figaro
com.crashnote
com.darylteo.vertx
com.douban
com.eclipsesource.tabris
com.f2prateek.ln
com.facebook.hive
com.facebook.presto.hadoop
com.flowlogix
com.ganyo
com.getperka.sea
com.github.axel22
com.github.axet.play
com.github.benhutchison
com.github.chrisbanes.actionbarpulltorefresh
com.github.corydoras
com.github.drapostolos
com.github.genthaler
com.github.hexx
com.github.houbie
com.github.jond3k
com.github.jrh3k5
com.github.kospiotr
com.github.kubatatami
com.github.lotsabackscatter
com.github.marceloemanoel
com.github.martins1930.gradle
com.github.mperry
com.github.nicosensei.batch
com.github.pellaton.config-validation-processor
com.github.provigen
com.github.pukkaone
com.github.rest-driver
com.github.riccardove.easyjasub
com.github.safrain
com.github.scala-blitz
com.github.scaldi
com.github.scodec
com.github.shyiko
com.github.shyiko.mappify
com.github.sinall
com.github.smokestack
com.github.tanob
com.github.thehilikus.jrobocom.samples.simple
com.github.tkurz.sesame
com.github.wnameless
com.github.wookietreiber.sfreechart
com.google.appengine.tools
com.google.code.gwtsecurity
com.google.code.ndef-tools-for-android
com.google.code.sortpom
com.google.web.bindery
com.googlecode.cmake-maven-project
com.googlecode.i18n-maven-plugin
com.googlecode.protobuf-rpc-pro
com.googlecode.stackexchange
com.greenbird
com.ibm.jaggr
com.impossibl.stencil
com.iorga
com.iotake.suller
com.j256
com.jakewharton.timber
com.jartifacts
com.jasonclawson.dropwizardry
com.jayway.restassured.examples
com.kagurabi.shared
com.logscale
com.lonepulse
com.loopfor.zookeeper
com.mahanaroad
com.mcxiaoke.popupmenu
com.milaboratory
com.neenbedankt.bundles
com.netbout
com.networkedassets
com.nfsdb
com.ning.maven.plugins
com.notuvy
com.novoda
com.novoda.imageloader
com.openxcplatform
com.peircean.libgfapi-jni
com.phloc
com.proofpoint.discovery
com.purej
com.rackspace.cloud.api
com.rockymadden.delimited
com.rudolfschmidt
com.samaxes.stripes
com.seagate.kinetic
com.sharneng
com.sibvisions.jvx
com.simpligility.org.apache.maven.plugin-testing
com.sksamuel.elastic4s
com.sksamuel.elasticsearch
com.sksamuel.scoverage
com.slicklog
com.snappydb
com.socratica.mobile
com.soebes.maven.plugins
com.sonian
com.soulgalore
com.sourcesense.solr
com.sqality.scct
com.squareup.dagger.example
com.squareup.mortar
com.squareup.okhttp.sample
com.squareup.picasso
com.stormpath.sdk
com.stratio.cassandra
com.sun.javaee6.samples
com.sun.jersey.samples.atompub-contacts
com.synchronica.mep
com.tacitknowledge.maven.plugins
com.taoensso
com.thalesgroup.dtkit
com.thesamet
com.thinkfree.android
com.tikinou.oss
com.tngtech.java
com.tobedevoured.modelcitizen
com.top10
com.totsp.feedpod
com.tourapp.config
com.tourgeek.config
com.tupilabs
com.twitter.ambrose
com.typesafe.sbt
com.tzavellas
com.uwetrottmann
com.willowtreeapps.saguaro
com.xeiam
com.xpn.xwiki.platform.tools
com.yahoo.oozie
com.zvoykish
cornerstone-threads
cz.jirutka.spring
de.akquinet.android.roboject
de.bripkens
de.cinovo.cloudconductor
de.codecentric.zucchini
de.crowdcode.kissmda.cartridges
de.crowdcode.kissmda.maven
de.eonas.portal.demo
de.ipk-gatersleben
de.knutwalker
de.larmic
de.learnlib.archetypes
de.psdev
de.rhauswald.guice.hessian.hessian-guice
de.saly
de.saxsys
de.sstoehr
de.xwic.etlgine
edu.berkeley.cs
edu.berkeley.cs.amplab.adam
edu.ucdenver.ccp
edu.washington.cs.knowitall.chunkedextractor
edu.washington.cs.knowitall.taggers
es.arcadiaconsulting.appstorestats
eu.agrosense.apps
eu.headcrashing.treasure-chest
eu.inmite.android.lib
eu.kratochvil.perfmon
eu.rekisoft.android
eu.scape-project.nanite
excalibur-event
excalibur-lifecycle
exist
exo-platform
external.atlassian.json
foxtrot.foxtrot
fr.avianey
fr.norad.bootstrap
fr.norad.jaxrs.client.server
fr.pilato.elasticsearch.river
fr.zebasto.dailymotion
gr.skroutz
ie.corballis
im.yagni
info.flex-mojos
info.folone
info.projectkyoto
io.cloudsoft.jclouds.common
io.cloudsoft.jclouds.labs.management
io.cloudsoft.networking
io.ehdev.testify
io.github.arjunguha
io.github.jhipster.loaded
io.github.reggert
io.graceland
io.hawt.example.services
io.joynr.cpp
io.joynr.java
io.joynr.java.common
io.joynr.java.core
io.joynr.tools.generator
io.kazuki
io.konverge
io.libraft
io.motown.identification-authorization
io.mth
io.prometheus.client.utility
io.searchbox
io.sphere
io.sprucehill
io.staticcdn.sdk
io.tesla.aether
it.nerdammer
james
jmaki
jp.skypencil.findbugs.slf4j
jparsec
lt.velykis.maven.skins
maven-proxy
me.fhir
me.frmr.newrelic
me.noroutine
mobi.liason
mx.com.inftel.oss
name.didier.david
name.heikoseeberger
net.anthavio
net.antidot
net.automatalib.archetypes
net.benmur
net.cilib
net.gageot
net.hamnaberg
net.java.loci
net.java.openjfx.backport
net.jawr.extensions
net.jawr.tools
net.jeremybrooks
net.joelinn
net.kieker-monitoring
net.ledem
net.loadbang
net.lshift.diffa
net.masterthought
net.objectlab
net.objectlab.kit.datecalc
net.peachjean.tater
net.redhogs.sbt
net.riccardocossu.autodoc
net.ripe.rpki
net.saliman
net.seedboxer
net.sf
net.sf.beaver
net.sf.buildbox.maven
net.sf.docbook
net.sf.jlue
net.sf.juffrou
net.sf.logdistiller
net.sf.logdistiller.logtypes
net.sf.maven-autotools
net.sf.mgp
net.sf.opk
net.sf.oqt.test
net.sf.portletunit
net.sf.uadetector
net.sf.uctool
net.sourceforge.messadmin
net.sourceforge.plantuml-depend
net.therore
net.unit8.maven.plugins
net.virtalab
nl.elucidator.patterns.builder.annotations
nl.pvanassen
no.arktekk.atom
nz.ac.auckland.syllabus
nz.co.aetheric.shiva
org.aerysoft.minijson
org.anarres.gradle
org.andromda.maven.site
org.apache.axis2.maven2
org.apache.cxf.build-utils
org.apache.cxf.services.wsn
org.apache.deltaspike.test
org.apache.directory.jdbm
org.apache.excalibur.fortress.container
org.apache.flume.flume-ng-sources
org.apache.geronimo.assemblies
org.apache.geronimo.gshell.remote
org.apache.jclouds.labs.management
org.apache.kalumet
org.apache.karaf.bundle
org.apache.karaf.cellar.samples.dosgi.greeter
org.apache.karaf.demos
org.apache.karaf.eik.features
org.apache.karaf.itests
org.apache.karaf.region
org.apache.karaf.scr
org.apache.karaf.scr.examples
org.apache.karaf.service
org.apache.myfaces.extensions.cdi
org.apache.myfaces.extensions.validator.test-modules
org.apache.myfaces.maven
org.apache.ode.examples
org.apache.servicemix.examples.cxf-wsdl-first-osgi-package
org.apache.servicemix.jbi.cluster
org.apache.shiro.samples
org.apache.turbine
org.apache.tuscany.sca.aggregation
org.arquillian.spacelift
org.asciidoctor
org.atmosphere.wasync.samples
org.atteo.config
org.bdgenomics.adam
org.beangle.db
org.beangle.security
org.beangle.struts2
org.beetl
org.bgee.log4jdbc-log4j2
org.bigtesting
org.bitbucket.gabysbrain
org.bitbucket.joxley
org.bitbucket.openisoj
org.bitstrings.eclipse.m2e.connectors.dependencypath
org.bitstrings.eclipse.m2e.connectors.jaxb2
org.bitstrings.eclipse.m2e.connectors.xmlbeans
org.bitstrings.maven.plugins
org.bongiorno
org.bonitasoft.engine
org.cache2k
org.camunda.bpm.webapp
org.cementframework
org.cloudera.htrace
org.codehaus.fabric3.tomcat
org.codehaus.groovy.modules
org.codehaus.mojo.hibernate3
org.codehaus.sonar-plugins.pdf-report
org.codehaus.sonar-plugins.xml
org.coderu
org.commonjava.vertx
org.coosproject.maven.archetypes
org.cornutum.tcases
org.dbtools
org.deephacks.graphene
org.deephacks.lmdb
org.deephacks.lmdbjni
org.droidparts
org.dspace.maven.plugins
org.dspace.oclc
org.easetech
org.eclipse.core.filesystem.linux
org.eclipse.emf.ocl
org.eclipse.emf.workspace
org.eclipse.equinox.launcher.gtk.linux
org.eclipse.gemini
org.eclipse.jst.jee
org.eclipse.mylar.monitor
org.eclipse.mylar.tasks
org.eclipse.platform.source.linux.gtk
org.eclipse.rcp.source.linux.gtk
org.eigengo.akka-extras
org.ektorp
org.eobjects.metamodel-extras
org.evactor
org.everit.osgi.bundles
org.everrest
org.exoplatform.calendar
org.exoplatform.commons
org.exoplatform.ecm.dms.core
org.exoplatform.ecm.workflow
org.exoplatform.webos
org.flatland
org.fuin.srcgen4j
org.fusesource.examples.fabric-camel-cluster
org.fusesource.fabric.bridge
org.fusesource.fabric.fabric-examples.fabric-camel-cluster
org.gagravarr
org.gatein.api
org.geirove.exmeso
org.glassfish.docs
org.glassfish.findbugs
org.glassfish.jersey.archetypes
org.glassfish.jersey.connectors
org.glassfish.jersey.containers.glassfish
org.glassfish.main.ha
org.glassfish.tyrus.bundles
org.glassfish.tyrus.ext
org.glassmaker
org.golo-lang
org.greencheek.mq
org.hibernate.build.gradle
org.hibernate.hql
org.impalaframework.extension
org.infinispan.archetypes
org.infinispan.protostream
org.isuper
org.jasig.ssp.platform
org.javabits.jgrapht
org.javers
org.jboss.aerogear.test.arquillian
org.jboss.ejb3.async
org.jboss.ejb3.context
org.jboss.ejb3.timerservice
org.jboss.jbossts.arjunacore
org.jboss.jsf.integration
org.jboss.narayana
org.jboss.narayana.jts
org.jboss.narayana.xts
org.jboss.osgi.runtime
org.jboss.portal.common
org.jboss.reloaded
org.jboss.resteasy.test
org.jboss.seam.forge
org.jboss.seam.international
org.jboss.seam.jms
org.jboss.seam.servlet
org.jboss.seam.wicket
org.jboss.soa.dsp
org.jboss.spec
org.jboss.webbeans.integration
org.jboss.ws.projects
org.jbundle.app.contact
org.jbundle.util.other
org.jclouds.cli
org.jfrog.artifactory.client
org.jibx.schema.org.jibx.test
org.jibx.schema.org.xmlsoap.schemas
org.jipijapa
org.jogamp.joal
org.jogamp.jocl
org.jvnet.hudson.plugins.lavalamp
org.jvnet.jaxb2-commons
org.jvnet.updatecenter2
org.kasource.kaplugin
org.kie.remote.ws
org.kill-bill.billing.plugin
org.kuali
org.kuali.student
org.lestr.astenn
org.metawidget.modules.commons
org.metawidget.modules.js
org.metawidget.modules.jsp
org.metawidget.modules.static
org.mitre
org.mobicents.arquillian.container.mobicents
org.mobicents.core
org.mobicents.protocols.asn.docs
org.mobicents.protocols.ss7.docs
org.mobicents.protocols.ss7.tcap.docs
org.mobicents.resources.mscontrol
org.mobicents.servlet.sip.archetypes
org.mobicents.servlet.sip.docs
org.mobicents.slee.enabler.userprofile
org.mobicents.slee.resource.smack
org.modeshape.demo
org.mortbay.hightide
org.mortbay.jetty.example
org.mybatis.scala
org.nakedobjects.prototyping
org.neo4j.doc
org.neo4j.examples
org.netbeans.microedition.lcdui
org.netpreserve.openwayback
org.nuiton.wikitty
org.nuxeo.ecm.automation
org.objectstyle.cayenne
org.objectweb.fractal.juliac.dream
org.odlabs.wiquery
org.openengsb.persistence
org.openjdk.jol
org.opensextant
org.ops4j.pax
org.ops4j.pax.jpa
org.ops4j.pax.jpa.samples
org.ops4j.pax.shiro
org.ops4j.pax.shiro.samples
org.ops4j.pax.url.itest
org.ops4j.pax.web.archetypes
org.ops4j.pax.wicket.samples.plain
org.ops4j.xvisitor
org.osgilab.bundles.shell
org.ow2.bonita.engine
org.ow2.chameleon.fuchsia
org.ow2.chameleon.fuchsia.push
org.ow2.chameleon.fuchsia.tools
org.ow2.chameleon.mail
org.ow2.easywsdl.extensions
org.ow2.frascati.examples.scala
org.ow2.jonas.assemblies.profiles.legacy
org.ow2.sirocco.cimi
org.ow2.util.pool
org.ow2.xlcloud.xsa
org.ow2.xlcloud.xsa.ext.hpc
org.owasp.encoder
org.pacesys
org.papoose.cmpn
org.papoose.test.bundles
org.picketlink.idm.testsuite
org.pivot4j
org.plutext
org.purplejrank
org.pustefixframework.webservices
org.rauschig
org.realityforge.gwt.appcache
org.requs
org.richfaces.ui.iteration
org.richfaces.ui.misc
org.scala-tools.archetypes
org.scala-tools.javautils
org.scala-tools.subcut
org.scaladci
org.scoverage
org.sellmerfud
org.sevensource.commons
org.soitoolkit.tools.generator
org.sonatype.install4j
org.sonatype.m2e.egit
org.sonatype.m2e.hudson
org.sonatype.maven.shell.dist
org.sonatype.nexus.maven
org.sonatype.tycho.m2e
org.springframework.aws
org.springframework.plugin
org.standardout
org.staxnav
org.storychat
org.swordapp
org.trippi
org.usb4java
org.vvcephei
org.wikimedia.search.highlighter
org.xenei
org.xerial.maven
org.xtext
org.xwiki.manager
pl.wavesoftware
ro.nextreports
ru.concerteza.spring-embedded-tomcat
ru.yandex.qatools.matchers
se.skltp.adapterservices.druglogistics.dosdispensing
se.ugli.habanero.servlet-driver
se.unbound
se.vgregion.notifications
se.vgregion.oppna-program-bookmarks-jsf
se.vgregion.vertikala-prioriteringar
sun-jaxws
tambora
ua.gradsoft
ua.mobius.media.io
uk.ac.ebi.gxa
uk.ac.gate
uk.bl.wa.discovery
uk.co.datumedge
uk.co.optimisticpanda
uk.co.webamoeba.mockito.collections
uk.gov.hmrc
uk.org.retep.tools.maven
us.fatehi
ymsg
com.carrotgarden.log
com.cj.qunit-test-driver
com.dmitriy-tarasov
com.github.ffpojo
com.github.mhendred.face4j
com.googlecode.eventio
com.mergere.mvnbook.proficio
com.moksamedia
de.agilecoders.maven
de.akquinet.android.marvin
de.huxhorn.gradle
fi.evident.enlight
it.tidalwave.imageio
it.unibo.alice.tuprolog
net.agile-automata.executor4s
net.java.dev.footprint
net.rforge
net.sf.snmpadaptor4j
org.axonframework.samples
org.foxlabs
org.papoose.osgi
org.puremvc
org.sevensource
se.l4.crayon
org.objectweb.fractal.juliac.juliet
com.drewnoakes
org.glassfish.jdbc.jdbc-ra.jdbc-core
org.glassfish.main.jdbc.jdbc-ra.jdbc-core
org.ocpsoft.common
org.mobicents.servers.jainslee.api
org.scala-sbt
org.sakaiproject.message
com.sun.xsom
freemarker
proxool
ldapsdk
com.dmurph
biz.source_code
org.fusesource.restygwt
com.jhickman
org.mobicents.protocols.ss7.isup
org.mobicents.protocols.ss7.tcap
sax
de.bwaldvogel
org.apache.ddlutils
htmlunit
org.apache.santuario
com.facebook.hadoop
com.google.android.tools
isorelax
org.mod4j.org.eclipse.jface
org.apache.clerezza.scala
javax.help
com.icegreen
org.jbundle.thin.opt
org.jboss.spec.javax.ws.rs
com.google.gwt.inject
de.fau.cs.osr.utils
com.sna-projects.krati
org.apache.activemq.protobuf
org.eclipse.jst.ws.consumption
com.sun.xml.messaging.saaj
com.esotericsoftware.kryo
org.knowhowlab.osgi.testing
org.mobicents.protocols.ss7.inap
org.ow2.petals.wsstar.oasis-ws-topics
org.objectweb.fractal.fractalswing
com.google.code.maven-play-plugin.org.allcolor.yahp
org.apache.openwebbeans.test
net.sourceforge.htmlcleaner
org.eclipse.ecf.presence
com.googlecode.objectify
com.nineoldandroids
br.com.ingenieux.maven.annomojo
commons-primitives
com.opera
net.sourceforge.jplasma
org.eclipse.gmf.graphdef
org.seleniumhq.selenium.server
de.akquinet.android.androlog
org.codehaus.generama
com.googlecode.java-diff-utils
org.gaixie.jibu
net.peachjean.commons
org.jibx.schema.net.webservicex
org.jvnet.com4j.typelibs
uk.co.jemos.protomak
org.coconut.cache.test
it.cnr.isti.domoware.cyberdomo
org.eclipse.wst.internet.monitor
com.cenqua.clover
edu.stanford.nlp
org.jruby.ext.posix
org.eclipse.jst.common.project.facet
com.ning.arecibo
org.eclipse.wst.css
net.sourceforge.saxon
org.jdtaus.core.lang
net.sf.ezmorph
org.eclipse.wst.common.emfworkbench
org.testatoo.openqa
org.codehaus.mojo.groovy.support
net.officefloor.tool
org.sakaiproject.contentreview
javax.enterprise.concurrent
org.openqa.selenium.server
org.apache.maven.release
org.commonjava.couch.test
net.sf.extcos
org.tuckey
org.eclipse.jst.jsp
net.sf.gwt-widget
org.erlang.otp
xtc
org.sonatype.nexus.indexer-lucene
org.kitchen-eel
org.appspy.client
org.hrodberaht
com.google.code.maven-play-plugin.org.apache.hadoop
scout
org.jsecurity
org.sonatype.maven
edu.cmu.lti.oaqa.cse
org.neodatis.odb
org.eclipse.jst.ws.axis2
net.wimpi
org.codehaus.cake.attributes
org.eclipse.jsch
org.eclipse.wst.html
tablelayout
gnu.getopt
ch.ethz.ganymed
org.sonatype.sisu.pr
org.compass-project
com.sun.msv.datatype.xsd
org.jboss.errai.reflections
org.jboss.jsr299.tck
org.andromda.templateengines
org.jvnet.mock-javamail
org.codehaus.staxmate
grizzly
org.onehippo.cms7
org.eiichiro.jazzmaster
com.bitmechanic
com.facebook.api
com.framework-x
com.github.chrisbanes.bitmapcache
com.googlecode.injectlet
com.jayway.jax-rs-hateoas
com.leshazlewood.scms
com.sematext
com.strategicgains.domain-eventing
com.tooltwist
com.unboundedprime.tapioca
hu.kazocsaba.geom3d
net.dharwin.common.tools.cli
net.ftlines.wicket-bean-validation
net.israfil.micro
net.jxta
net.micwin.tindata
net.saik0.android.unifiedpreference
net.sf.jt400
net.stickycode.servlet
net.vatov
nl.pwiddershoven.jfactory
org.apache.servicemix.examples.camel
org.appspy.admin
org.appspy.viewer
org.beangle.notification
org.bitbucket.dollar
org.codehaus.cake.cache.test
org.commonjava.atservice
org.features-runner
org.glassfish.admin.runtime.rtapt
org.hrodberaht.directus
org.krysalis
org.lazydog.mbean
org.ow2.easybeans.classloader
org.ow2.util.component
org.projectodd.shimdandy
uk.co.rgordon
com.googlecode.concurrentlinkedhashmap
org.sonatype.plexus.appevents
org.eclipse.gmf.codegen
net.sourceforge.f2j
fop
com.jayway.maven.plugins.android.generation1
javax.security.jacc
org.eclipse.gmf.runtime
net.sf.transmorph
org.eclipse.wst.command
net.sf.barcode4j
org.gridkit.coherence-tools
javax.json
org.mobicents.protocols.ss7.cap
org.jvnet.opendmk
eu.medsea.mimeutil
com.sun.scn
org.objectweb.dream.dreamcore
org.sonatype.sisu.jira.mediator
org.apache.karaf.assemblies.features
cc.spray.can
org.mod4j.org.eclipse.emf.ecore
org.mobicents.media.client
com.projectdarkstar.tools.test
uk.com.robust-it
org.apache.directory.daemon
net.sf.jsr107cache
com.puppycrawl.tools
org.perf4j
org.sakaiproject.velocity
org.jomc.standalone
org.virtualbox
org.fedorahosted.tennera
org.jboss.shrinkwrap.sip
org.ops4j.pax.tinybundles
de.pdark
org.outerj.daisy
com.healthmarketscience.jackcess
org.objectweb.util.explorer
javax.management
ca.juliusdavies
org.objectweb.fractal.bf.binjiu.runtime
org.objectweb.dream.dreamadl
com.googlecode.streamflyer
com.squareup.dagger
org.ow2.orchestra.common
net.sf.cotta.testbase
maven-taglib
com.lmax
org.eclipse.jdt.apt
org.glassfish.main.concurrent
org.gaixie.jibu.plugins
com.jayway.jsonpath
org.commonjava.qarqas
saxpath
net.sf.hibernate
net.sf.staf
com.github.cwilper
axion
org.eclipse.jdt.debug
com.youdevise
org.primefaces
org.gitective
org.randombits.support
org.ow2.scarbo.runtime
org.fusesource.mqtt-client
xmlenc
org.reddwarfserver.tools.test
org.libvirt
com.asual.lesscss
com.barchart.kitfox
com.denormans.facebook-gwt
com.fastmessenger
com.github.ansell.aterms
com.github.lkoskela
com.github.mongoutils
com.github.podal.codejavadoc
com.github.rbuck
com.github.sworm
com.googlecode.wicked-forms
com.higherfrequencytrading
com.nemrod-software
com.octo.android.robodemo
com.projectdarkstar.services
com.steeplesoft.jsf
com.sun.grizzly.contribs
com.tonicartos
com.vaynberg.wicket.select2
com.zaubersoftware.commons.image
dk.clanie
in.uncod.android.bypass
me.jaimegarza
net.java.dev.sommer
net.mailjimp
net.oneandone.testlinkjunit
net.sf.aislib.tools.entities
net.sf.jsci
net.sf.tie
net.sf.xolite
net.sourceforge.jdbcimporter
net.sourceforge.reqtracer.mojo
net.spy
org.apache.felix.karaf.tooling
org.apache.ws.scout
org.fosstrak.llrp
org.mortbay.jetty.npn
org.objectweb.fractal.bf.examples.amazon
org.objectweb.fractal.bf.examples.meteo
org.objectweb.fractal.fractaladl.juliac.plugin
org.ow2.fractal.bf.binjiu.runtime
org.ow2.fractal.bf.examples.amazon
org.ow2.fractal.bf.examples.meteo
org.ow2.util.jmx
org.sonatype.nexus.obr
org.sonatype.nexus.repository.site
org.sonatype.nexus.yum
org.uncommons.watchmaker
org.jsdoctoolkit
org.imgscalr
net.sf.jstring
org.hudsonci.xpath
org.sonatype.runtime
org.jibx.schema.org.apache.maven
com.googlecode.multithreadedtc
com.fifesoft.rtext
com.google.code.tempus-fugit
net.sourceforge.plantuml
commons-chain
doxia
org.codehaus.cake.forkjoin
org.codehaus.cake.ops
org.andromda.andromdapp
org.ostermiller
org.divxdede
cc.spray.json
com.nesscomputing.migratory
net.sourceforge.jregex
com.jayway.android.robotium
org.sakaiproject.site
org.jboss.spec.javax.security.auth.message
com.googlecode.javaewah
org.objectweb.jonathan
org.prefuse
org.jboss.jbossas.as7-cdi-tck
org.apache.myfaces.portlet-bridge
com.github.stephenc
com.google.mockwebserver
junitperf
javax.interceptor
org.mobicents.protocols.asn
com.googlecode.lambdaj
br.com.caelum.tubaina
ch.poweredge.ntlmv2-auth
com.kilnhg.tim-sparg
com.michaelalynmiller
com.sun.bigbrother.javanet
com.zenika
de.novanic.gwteventservice.demo.conversation
gs.hitchin.hitchfs
io.blitz
net.encomendaz
net.israfil.services.mail
net.java.openjdk.cacio
net.sf.lucis
net.sf.seideframework
net.thucydides.easyb
org.bitbucket.deepdiff
org.codeartisans.shiro
org.eluder.juniter
org.glassfish.main.batch
org.huahinframework
org.jbehave.site
org.jdtaus.icons
org.mybatis.generator
org.neociclo.accord.odetteftp
org.ow2.chameleon.sharedprefs
org.ow2.chameleon.twitter
org.ow2.util.audit
org.picocontainer.jetty
org.sitemesh
org.zdevra.sparrow
ru.studiomobile
se.spagettikod
net.sourceforge.wicketwebbeans
org.protege
com.extjs
org.eclipse.jst.ws.axis2.consumption
org.ow2.frascati.upnp
org.sonatype.configuration
javax.xml.registry
lucene
org.apache.geronimo.gshell.wisdom
p6spy
net.adamcin.commons
org.glassfish.main.appclient.server
org.eclipse.wst.wsdl
org.picketlink.idm.integration
org.apache.james.jspf
net.sourceforge.jexcelapi
com.allen-sauer.gwt.dnd
asia.redact.bracket.properties
com.atomicleopard
com.barchart.http
com.fizz-buzz
com.github.alinvasile.jsla
com.github.japgolly.android.test
com.github.jasarus
com.github.sps.notifo4j
com.github.stokito
com.github.tomakehurst
com.googlecode.linkedin-j
com.lexicalscope.eventcast
com.pastdev
net.sf.aislib.tools.mapping
net.zeroinstall.pom2feed
nz.ac.waikato.cms.moa
org.battelle
org.bitbucket.timemachine
org.codehaus.xdas4j
org.commonjava.ssl
org.crazyjavahacking.astvisualizer
org.devcake.groovy
org.eclipse.wst.server.http
org.junithelper
org.kohsuke.droovy
org.marssa
org.mirah
org.openengsb.domains.scm
org.ow2.ishmael
ru.yandex.qatools.actions
se.vgregion.tasklist
com.io7m.jaux
org.apache.cocoon.pipeline
fm.void.jetm
org.apache.cassandra.deps
org.jboss.classfilewriter
org.apache.aries.web
org.sakaiproject.emailtemplateservice
org.ow2.chameleon.testing
com.infradna.tool
org.eclipse.wst.javascript
org.richfaces.core
com.experlog
com.projectdarkstar.ext.berkeleydb
com.googlecode.catch-exception
cc.catalysts
com.adobe.flex
com.github.verylazyboy
com.googlecode.androidannotations
com.googlecode.jperipheral
com.jeffrodriguez
com.zipwhip
net.darkmist.alib.escape
net.droidlabs.android.audio.ogg
net.sf.chex4j
net.sourceforge.retroweaver
org.apache.myfaces.extensions.validator.validation-modules
org.jtestr
org.mongojack
org.objectweb.fractal.fractalexplorer.examples
org.openengsb.domains.report
org.ow2.easybeans.extensions
se.grunddata.dzo
de.linuxusers.levenshtein
org.apache.aries.ejb
org.ow2.util.file
org.eclipse.hudson.stapler
org.eclipse.gmf.runtime.notation
org.objectweb.medor
org.fusesource.stompjms
directory-protocols
com.exadel.flamingo.flamingoapp.projects
com.jasonbaldridge
com.restphone
com.smartitengineering
de.brands4friends.daleq
dk.eobjects.datacleaner
edu.nps.moves
eu.cdevreeze.springtx
io.viper
net.java.balloontip
net.moetang
net.sf.xradar
net.sourceforge.parallelcolt
netbeans
org.openengsb.domains.issue
org.openengsb.domains.notification
org.ow2.jasmine.jade.wrapper
org.ow2.scarbo.service
org.permians
org.threeten
se.vgregion.oppna-program-navigation
org.jvnet.mimepull
tyrex
de.devsurf.tools
nl.jqno.equalsverifier
org.jboss.remotingjmx
net.oauth
org.springframework.security.oauth
org.ow2.spec.osgi
net.htmlparser.jericho
com.bimbr
com.iggroup.oss.restdoclet
org.bsc.framework
org.codegist.crest
org.ow2.chameleon.syndication
org.tomdz.twirl
se.vgregion.oppna-program-piwik-tracking
org.floggy.3rd.org.eclipse
org.floggy.3rd.org.eclipse.equinox
org.floggy.3rd.org.eclipse.ui
org.apache.cocoon.sitemap
com.outr.webcommunicator
avalon-logkit
com.projectdarkstar.ext.neakor
org.jboss.osgi
ch.bbv.fsm
com.cedarsoft.tags
com.digitolio
com.googlecode.refit.maven
io.qdb
net.fortytwo
net.jp.saf.sastruts
net.sf.formlayoutmaker
net.sf.jped
org.ow2.chameleon.chat
org.polyglotted.attributerepo
org.synchronoss
org.openarchitectureware
org.agilewiki.jactor
org.eclipse.jst.ws.axis.consumption
org.eclipse.mylyn.ide
com.github.epabst.scala-android-crud
com.github.mavenplugins.maven-doctest-plugin
com.sun.jersey.test.osgi.runtime-delegate-tests
edu.gmu.cs
org.eclipse.birt
org.sonatype.nexus.plugins.capabilities
org.uncommons
org.mobicents.javax.sip
sysunit
urbanophile
com.atlassian.confluence.plugin
com.bpodgursky
com.discursive.web.history
com.github.ansell.sesame-rio-extensions
com.googlecode.jdbc-proc.jdbc-proc
com.zaubersoftware.commons.message
de.andrena.tools.macker
org.endea
org.mpierce
org.randombits.filtering
org.ini4j
org.eclipse.emf.common
org.pushing-pixels
edu.stanford.ejalbert
jboss.jboss-embeddable-ejb3
com.rimerosolutions.ant
com.squeakysand.sling
com.sun.grizzly.osgi
com.sun.jersey.samples.helloworld-osgi-webapp
com.sun.jersey.samples.osgi-http-service
edu.berkeley.nlp
org.apache.james.jdkim
org.apache.karaf.system
org.glassfish.appclient.server
org.openengsb.domains.example
org.pushingpixels
net.awired.aclm
org.testatoo.cartridge
org.jvnet.hudson.dom4j
com.brewtab
com.codeminders
edu.mit.simile
org.codehaus.service-conduit.webapp
org.eclipse.mylyn.jira
org.eclipse.mylyn.trac
org.jboss.jbossts.xts
org.openengsb.labs.delegation
org.ow2.util.deploy
org.sakaiproject.shortenedurl
net.sf.beanlib
toplink.essentials
com.linkedin
org.eclipse.wst.xsd
com.joestelmach
io.backchat.jerkson
org.eclipse.wst.dtd
org.fusesource.maven.doxia
org.jvending.registry
org.resteasy
se.vgregion.oppna-program-vap
sun-jaf
com.googlecode.clearnlp
org.objectweb.util
com.netflix.governator
com.smartgwt
com.tinkerpop
eu.tekul
io.trygvis.usb
org.cloudfoundry.identity
org.eclipse.jst.server.tomcat
org.glassfish.external.trinidad
jasperreports
commons-dbutils
org.connid.bundles.soap
com.google.code.jetm
org.jboss.jdocbook
org.sakaiproject.delegatedaccess
org.syncope.identityconnectors.bundles.staticws
pl.nk
se.vgregion.tyck-till
com.google.code.maven-play-plugin.org.eclipse.jdt
org.eclipse.jst.ws.axis2.creation
org.ow2.chameleon.i18n
net.nisgits.executablewar
jruby
com.zaubersoftware.commons.repository.impl
org.eclipse.mylyn.team
org.cassandraunit
org.jharks
trove
com.github.stephenc.scale7
org.sakaiproject.accountvalidator
se.vgregion.signer-service-schemas
org.eclipse.wst.validation
org.andromda.samples.carrental
org.andromda.samples.crud
org.ops4j.pax.wicket.samples.service
ws.ladder
com.googlecode.wabacus
piccolo
org.jboss.seam.integration
org.andromda.samples.animalquiz
org.objectweb.asm
org.apache.directory.installers
org.javaruntype
org.eclipse.ltk.core
commons-compress
org.quartz-scheduler.internal
org.eiichiro.reverb
idb
activespace
amalloy
at.newmedialab.lmf
at.schmutterer.oss.jpatest
atlassian-browsers
avalon-extension
avalon-http
be.billington.android.light-sensitive-color
be.hikage
be.jlr-home.gradle
be.novelfaces
biz.paluch.redis
br.com.arbo.swinginsulation
br.com.flexait
br.com.six2six
br.com.tecsinapse
ca.uhn.hapi.fhir
cc.qbits
cc.twittertools
ch.cern
ch.cern.dirq
ch.ralscha
ch.sbb.maven.archetypes
ch.sbb.maven.plugins
clojurewerkz
clover
cn.jhc
cn.wensiqun
co.blocke
com.adaptc.mws
com.adaptc.mws.plugins
com.aestasit.infrastructure.sshoogr
com.agilarity
com.agilistanbul
com.akiban
com.alexecollins.docker
com.almworks.integers
com.amazon.device.tools.build
com.andrewmcveigh
com.antwerkz.afton
com.api-tech
com.appthwack
com.arconsis
com.ariht
com.artofsolving
com.atlassian.administration
com.atlassian.bamboo.plugin
com.atlassian.bamboo.plugins.builder
com.atlassian.bundles
com.atlassian.cache
com.atlassian.confluence.cache
com.atlassian.confluence.extra.team-calendars
com.atlassian.confluence.plugins.gadgets
com.atlassian.confluence.rpc
com.atlassian.connector
com.atlassian.dragonfly
com.atlassian.federation
com.atlassian.integrationtesting
com.atlassian.jira.welcome
com.atlassian.johnson
com.atlassian.labs.hipchat
com.atlassian.org.eclipse.sisu
com.atlassian.plugin
com.atlassian.plugin.deflection
com.atlassian.plugin.notifications
com.atlassian.plugins.shortcuts
com.atlassian.pom
com.atlassian.qunit
com.atlassian.sandbox
com.atlassian.spring
com.atlassian.theplugin
com.atlassian.user
com.auth0
com.backstopsolutions
com.basistech
com.bazaarvoice.ostrich
com.bazaarvoice.ostrich.zookeeper
com.beachape.filemanagement
com.bericotech
com.betfair.sre
com.betfair.tornjak
com.bionicspirit
com.bitalino
com.bradneighbors.buildable
com.bugsnag
com.campudus
com.capgemini.platina.maven
com.carmanconsulting.cassidy
com.casualmiracles
com.cathive.fonts
com.cedarsoft.commons.spring
com.cedarsoft.open
com.cedarsoft.open.archetype
com.cedarsoft.serialization.commons-serializers
com.cedarsoft.serialization.test
com.cedarsoft.unit
com.celexus
com.cisco.oss.foundation.queue
com.cisco.step.jenkins.plugins
com.citrix.netscaler.nitro
com.citytechinc.cq.cq-component-plugin
com.cloudbees.sdk.plugins
com.cloudbees.thirdparty
com.cloudbees.util
com.cloudera.hue
com.cloudhopper.proxool
com.cloudinary
com.code-troopers.play
com.code972.hebmorph
com.codeborne
com.codebullets.saga-lib
com.codepoetics
com.cognifide.cq
com.colorfulsoftware
com.commongroundpublishing
com.creeaaakk
com.ctlok
com.daikit
com.dakuupa
com.darwinsys
com.darylteo.gradle
com.datasalt.pangool
com.datomic
com.db4o
com.deftlabs
com.deploygate
com.digitaldoodles
com.dooapp.fxform2
com.dottydingo.tracelog
com.dropbox.core
com.dwolla
com.eclecticlogic
com.eclipsesource
com.emitrom
com.esri.hadoop
com.evernote
com.everysport
com.exadel.flamingo
com.f2prateek.dart
com.facebook
com.fasterxml.jackson.jr
com.filmon.maven
com.flexdms
com.fotonauts
com.gemserk.animation4j
com.gemserk.resources
com.gestalt.common.injection
com.ggasoftware
com.ggasoftware.indigo
com.github.abirmingham
com.github.agilesteel
com.github.asilvestre
com.github.axet.litedb
com.github.axet.sqlite4java
com.github.bingoohuang
com.github.blueeyes
com.github.born2snipe
com.github.branflake2267
com.github.bringking
com.github.casmi
com.github.chrisbanes.photoview
com.github.chrisprice
com.github.concept-not-found
com.github.dactiv
com.github.daiksy
com.github.damage-control.report
com.github.danielpacak.jenkins.ci
com.github.danielwegener.xjc
com.github.davidhoyt
com.github.devnied.emvnfccard
com.github.dirkraft
com.github.dreamhead
com.github.dzwicker.wicket
com.github.eemmiirr.redisdata
com.github.ehc.tools
com.github.fedy2
com.github.fernandospr
com.github.filosganga
com.github.gwtd3
com.github.heuermh.ensemblrestclient
com.github.hoverruan
com.github.htfv
com.github.igor-petruk.archetypes
com.github.javawithmarcus.wicket-cdi-1.1
com.github.jdegoes
com.github.jeluard.parent-enforcer-rule.tests.multiple-correct
com.github.joel1di1
com.github.jonathannye.rpatch
com.github.julior
com.github.kaitoy.sneo
com.github.koraktor
com.github.lalyos
com.github.lbroudoux.elasticsearch
com.github.lookfirst
com.github.maiflai
com.github.maven-nar
com.github.mbenson.therian
com.github.miemiedev
com.github.mikesena.maven.plugins
com.github.misberner.duzzt
com.github.mttkay.memento
com.github.mumoshu
com.github.napp-com
com.github.nblair
com.github.nill14
com.github.nill14.patch1
com.github.nkzawa
com.github.nmorel.gwtjackson
com.github.nwillc
com.github.oehme.xtend
com.github.paginationspring
com.github.pathikrit
com.github.pedrovgs
com.github.phasebash
com.github.ptomli.bedrock
com.github.rahulsom
com.github.raphc
com.github.redfish4ktc.soapui
com.github.ruiyun.dvr4j
com.github.s4u.plugins
com.github.sassunt
com.github.scala-incubator
com.github.scan
com.github.scct
com.github.searls
com.github.seykron
com.github.skhatri
com.github.snowdream.android.app
com.github.snowdream.android.util
com.github.stefanliebenberg
com.github.stephenc.connectors
com.github.tasubo
com.github.thehilikus.jrobocom
com.github.theon
com.github.thiagolocatelli
com.github.trecloux
com.github.trevershick
com.github.triceo.splitlog
com.github.verbalexpressions
com.github.weekens
com.github.zhongl
com.goebl
com.goodow.vertx
com.google.code.bali-java
com.google.code.echo-maven-plugin
com.google.code.maven-config-processor-plugin
com.google.code.maven-play-plugin.spy
com.google.code.maven-replacer-plugin
com.google.code.maven-svn-revision-number-plugin
com.google.code.pomhelper
com.google.code.protoj
com.google.gag
com.google.gwt.gwtmockito
com.google.jimfs
com.googlecode.cassandra-jca
com.googlecode.charpa.charpa-wicket
com.googlecode.gettext-commons
com.googlecode.gwt-measure
com.googlecode.gwtmosaic
com.googlecode.ibaguice.datasource
com.googlecode.icegem
com.googlecode.maven-download-plugin
com.googlecode.msidor.maven.plugins
com.googlecode.page-component
com.googlecode.solr-geonames
com.googlecode.xdoclet-plugin-ignore
com.gravity
com.groupdocs
com.groupon.mysql
com.guerwan
com.guidewire.tools
com.hanhuy
com.hastybox
com.hencjo.summer
com.heroku
com.hubspot.jackson
com.hypnoticocelot
com.idfconnect.devtools
com.illposed.osc
com.impetus.kundera.core
com.impossibl.pgjdbc-ng
com.jakewharton.hugo
com.jamierf
com.jamierf.db-table
com.jasonclawson
com.java-adventures.security
com.jayway.maven.plugins.android.generation2
com.jcabi.incubator
com.jnape.palatable
com.joanzapata.android.kiss
com.joanzapata.pdfview
com.joescii
com.julianpeeters
com.kafeblog.vertx
com.kagurabi.services
com.kelveden
com.kenshoo
com.khipu
com.kurento.kws
com.larrymite
com.lazerycode.jmeter
com.leacox.dagger
com.lewisd
com.librato.metrics
com.liferay.cdi
com.lihaoyi.acyclic
com.lihaoyi.utest
com.linkedin.datafu
com.loopfor.scalop
com.luuuis
com.maginatics
com.maxmind.db
com.mcxiaoke.next
com.mcxiaoke.photoview
com.mindsnacks
com.mitchellbosecke
com.mobsandgeeks
com.mohiva
com.mojolly.inflector
com.mojolly.logback
com.mtvi.plateng.hudson
com.mycila.guice
com.myjeeva
com.natpryce
com.natpryce.hamcrest
com.navercorp
com.navercorp.volleyextensions
com.netaporter.gatling
com.netflix.exhibitor
com.netflix.rxnetty
com.netflix.schlep
com.netiq
com.newmainsoftech.eatestutil
com.newrelic.agent.java
com.nhncorp.jumble
com.nikhaldimann
com.nostra13.universalimageloader
com.novemberain
com.noveogroup.android
com.nowellpoint
com.nuecho
com.oglowo
com.ohadr
com.opennewway
com.opensymphony.propertyset
com.oracle.coherence.hibernate
com.osinka.httpbl
com.palantir
com.palominolabs.http
com.palominolabs.metrics
com.paulhammant
com.persist
com.plecting
com.polonium-framework
com.poolik
com.proinnovate
com.pseudocode.photolib
com.pubnub
com.redhat.victims
com.reevoo.taglib
com.relaynetwork
com.rempl.plugins
com.rest4j
com.rhcloud.mongodb
com.rhemsolutions
com.sachinhandiekar
com.samaxes.maven
com.savoirtech
com.scaleset
com.scireum
com.senseidb.zu
com.shazam
com.shesse.h2ha
com.signal7.devtools
com.sixsq.slipstream
com.sksamuel.scribble
com.slackworks
com.softwaremill.scalamacrodebug
com.specdevs
com.spinoco
com.springsource.insight
com.springsource.util
com.sprylab.android.texturevideoview
com.squareup.flow
com.squareup.jnagmp
com.squareup.retrofit.samples
com.squeakysand.devtools
com.stanfy.helium
com.storm-enroute
com.stratio.deep
com.stratio.streaming
com.streamsend
com.strongloop
com.sun.jbi
com.sun.jersey.glassfish.v32.osgi
com.sun.localizer
com.sun.pkg.bootstrap
com.sun.xml.rpc
com.sysgears.grain
com.tagdynamics
com.taskadapter
com.tecnoguru
com.terradue
com.terrafolio
com.testdroid
com.theoryinpractise.frege
com.timgroup.bildungsroman
com.toddfast.mutagen
com.traitify
com.treelogic-swe
com.tri-systems.ui.ldc
com.turn
com.twitter.hraven
com.unboundid.product.scim
com.uphyca.galette
com.uphyca.gradle
com.upokecenter
com.urbanairship
com.utest
com.uwemeding
com.vektorsoft.demux.android
com.versionone
com.viewstreet
com.webtide.hightide
com.wefika.gradle
com.weiglewilczek.sbteclipse
com.wesleyhome
com.wesleyhome.jpa
com.westerfeld.rewritehtml
com.wiris.plugin
com.xebia
com.xeiam.xchart
com.ymock.mock
com.yuvalshavit
com.yuvimasory.tostring
com.zaubersoftware.taglibs
com.zimory.jpaunit
com.zulily.dropship
commons-naming
commons-test
cornerstone-connection
cornerstone-datasources
cornerstone-scheduler
cornerstone-sockets
cornerstone-store
cz.geek
cz.jirutka.validator
d-haven-event
de.akquinet.android.rindirect
de.aktey.scanndal
de.apaxo.test
de.barop.gwt
de.codecentric.ccunit
de.cologneintelligence
de.crowdcode.kissmda
de.crowdcode.kissmda.profiles
de.cubeisland.maven.plugins
de.dagere.kopeme
de.devsurf.components.converter
de.exxcellent
de.grobmeier.json
de.holisticon.toolbox
de.is24.mavenplugins
de.jbellmann.maven.plugins
de.keyboardsurfer.android.widget
de.leanovate.toehold
de.learnlib.testsupport
de.lightful.maven.drools.plugin.its.test-artifacts
de.malkusch.amazon.product-advertising-api
de.matrixweb
de.mukis
de.mytoys.maven.plugins
de.neuland-bfi
de.newsarea.homecockpit
de.oscillation.kismet
de.pi3g.pi
de.psdev.formvalidations
de.psdev.licensesdialog
de.ralfebert
de.schlichtherle.truecommons
de.softwareforge.mojo
de.struller-baumann
de.svenkubiak
de.thksystems
de.tototec
de.tynne
de.weltraumschaf
de.xwic.appkit
drone
echo
edu.mit.findstruct
edu.rpi.twc.sesamestream
edu.sc.seis.gradle
edu.washington.cs.knowitall.ollie
elephantdb
eu.cdevreeze.springjdbc
eu.clarin.weblicht
eu.henkelmann
eu.kratochvil
eu.michael-simons
eu.numberfour.maven.plugins
eu.schnuckelig.gradle
eu.socialsensor
eu.verdelhan
excalibur-component
fi.evident.dalesbred
fi.foyt.paytrail
fi.gekkio.roboticchameleon
fi.hoski
fr.apyx
fr.avianey.mojo
fr.exanpe
fr.foop.ws
fr.inria.gforge.spoon.spoon-jdiet
fr.mastah.maven.plugin.m2e.jsdoc3
fr.masterdocs
fr.perigee
fr.sewatech.mqttra
gov.nasa
gov.nist.math
gr.ekt
gr.ekt.bte
guru.nidi.languager
hu.meza
hu.rxd
incanter
info.bliki.wiki
info.gehrels
info.hargrave.configuration
info.mikaelsvensson.devtools
innig
io.apigee.build-tools.enterprise4g
io.cloudsoft.amp
io.cloudsoft.jclouds.labs.representations
io.crossroads
io.fabric8.fab
io.fabric8.samples
io.gatling
io.github.divinespear
io.github.nremond
io.jdev.miniprofiler
io.joynr.tools
io.kadai
io.keen
io.konik
io.lamma
io.loli
io.motown.chargingstation-configuration
io.motown.operator-api
io.motown.vas
io.pdef
io.soliton
io.takari.aether
io.takari.maven
io.takari.maven.plugins
io.thekraken
io.theysay
io.tracee.outbound
it.unimi.di.law
jackson
jacl
javagroups
jaxb
jblanket
jboss.jms-integration-tests
jboss.maven-plugins
jp.co.acroquest.acromusashi
jp.co.worksap.workspace
jp.webpay
kiln
kr.motd.maven
ldapd-common
li.rudin.scheduler
locc
mc4j
me.bazhenov.groovy-shell
me.cmoz.grizzly
me.frmr.wepay-scala
me.masahito
me.trnl
me.zzp
mockcreator
mx.bigdata.utils
net.awired.bootstrap
net.awired.com.googlecode.jstestdriver
net.bytebuddy
net.canadensys
net.ceedubs
net.coderazzi
net.databinder.conscript
net.databinder.maven.net.databinder
net.devonlinux.solr
net.erdfelt.maven
net.ermannofranco
net.fortytwo.twitlogic
net.happyonroad
net.imadz
net.israfil.mojo
net.jakubholy.testing
net.jalg
net.java.dev.glassfish
net.java.jinput
net.java.spnego
net.java.timingframework
net.ju-n.commons-dbcp-jmx
net.kennychua
net.mindengine
net.northfuse
net.orfjackal.retrolambda
net.orpiske
net.projectmonkey
net.redhogs.actuarius
net.rumati.maven.plugins
net.rumati.sql
net.scriptability
net.sf.alchim.jedit
net.sf.carafe.jcarafe
net.sf.cathcart
net.sf.expectit
net.sf.fastupload
net.sf.flatpack
net.sf.ij-plugins
net.sf.itcb.archetype
net.sf.javaprinciples.core
net.sf.javaprinciples.data
net.sf.javaprinciples.persistence
net.sf.javaprinciples.resource
net.sf.javaprinciples.state
net.sf.javaprinciples.test
net.sf.javaprinciples.web
net.sf.jbddi
net.sf.jiapi
net.sf.jrtps
net.sf.jsignature.io-tools
net.sf.mapasuta.build.maven.plugins
net.sf.mastif
net.sf.maven-har
net.sf.maven-sar
net.sf.meka.thirdparty
net.sf.michael-o.tomcat
net.sf.sanity4j
net.sf.sparql-query-bm
net.sf.speculoos
net.sf.struts
net.shambolica.helperl
net.simonvt.schematic
net.snaq
net.sourceforge.ccxjc
net.sourceforge.pmd
net.sourceforge.reb4j
net.sourceforge.web-harvest
net.sourceforge.wife
net.sourceforge.winstone
net.stepniak.android
net.tirasa.openjpasqlazure
net.ttddyy
net.windwards
net.xp-forge.maven.plugins
nl.topicus
nl.topicus.plugins
no.entitas.gradle
no.entitas.gradle.jaxb
no.rmz
nz.ac.auckland.groupapps.lmz
nz.ac.waikato.modeljunit
nz.co.gregs
nz.net.catalyst
nz.net.ultraq.lesscss
nz.net.ultraq.preferences
open.jbi.components.maven.archetype
openjms
org.99soft.trudeau
org.agmip.translators.acmo
org.aicer
org.ajax4jsf
org.alfresco
org.anadix.integration
org.anarres
org.anarres.lzo
org.androidannotations
org.andromda.ant
org.andromda.bootstrap
org.ansj
org.apache.aries.versioning
org.apache.avalon.cornerstone.connection
org.apache.avalon.cornerstone.datasources
org.apache.avalon.cornerstone.scheduler
org.apache.avalon.cornerstone.sockets
org.apache.avalon.cornerstone.store
org.apache.avalon.cornerstone.threads
org.apache.batik
org.apache.cayenne.plugins
org.apache.cxf.archetype
org.apache.cxf.osgi.itests
org.apache.cxf.services.sts.systests
org.apache.cxf.services.ws-discovery
org.apache.cxf.systests.wsdl_maven
org.apache.deltaspike
org.apache.excalibur.event
org.apache.excalibur.fortress.meta
org.apache.flume.flume-ng-legacy-sources
org.apache.ftpserver.examples
org.apache.geronimo.applications
org.apache.geronimo.applications.magicGball
org.apache.geronimo.daytrader.javaee6
org.apache.isis.archetype
org.apache.isis.runtimes
org.apache.jclouds.labs.representations
org.apache.karaf.cellar.samples.camel.hazelcast
org.apache.karaf.config
org.apache.karaf.http
org.apache.karaf.instance
org.apache.karaf.jdbc
org.apache.karaf.jms
org.apache.karaf.jndi
org.apache.karaf.kar
org.apache.karaf.log
org.apache.karaf.management
org.apache.karaf.obr
org.apache.karaf.package
org.apache.karaf.web
org.apache.karaf.wrapper
org.apache.logging.log4j.samples
org.apache.mahout.watchmaker
org.apache.myfaces.extensions.cdi.modules.component-support
org.apache.myfaces.extensions.cdi.modules.jee5-support
org.apache.myfaces.extensions.validator.component-support-modules
org.apache.oltu.commons
org.apache.openjpa.openjpa-examples
org.apache.servicemix.examples.interceptors
org.apache.servicemix.management
org.apache.servicemix.nmr.examples
org.apache.servicemix.nmr.examples.interceptors
org.apache.servicemix.samples
org.apache.servicemix.samples.cxf-wsdl-first
org.apache.servicemix.samples.wsdl-first
org.apache.servicemix.servicemix.activemq
org.apache.sis.application
org.apache.sis.storage
org.apache.storm
org.apache.wookie
org.apidesign.brwsr
org.appfuse.plugins
org.armedbear.lisp
org.asteriskjava
org.atmosphere.patches
org.atmosphere.vertx.samples
org.atteo.classindex
org.atteo.filtering
org.avacodo
org.axonframework.incubator
org.beangle.spring
org.bgee.psp4jdbc
org.bitbucket.bradleysmithllc.maven-repository-launcher
org.bitbucket.cowwoc.preconditions
org.bitbucket.inkytonik.dsinfo
org.bitbucket.inkytonik.dsprofile
org.bitbucket.tbrugz
org.bitstrings.maven
org.browsermob
org.bsc.util
org.btc4j
org.camunda.bpm.model
org.camunda.commons
org.canedata
org.canedata.provider
org.carrot2.attributes
org.citationstyles
org.clojars.jasonjckn
org.codeartisans.asadmin-maven-plugin
org.codeartisans.javafx
org.codehaus.fabric3.fabric3-db-exist
org.codehaus.gmaven.archetypes
org.codehaus.gmaven.examples
org.codehaus.groovy.maven.archetypes
org.codehaus.groovy.maven.examples
org.codehaus.mevenide.plugins
org.codehaus.mojo.appassembler
org.codehaus.mojo.groovy.examples
org.codehaus.sonar-plugins.scm-activity
org.codemonkey.swiftsocketserver
org.commonjava.aprox.ui
org.commonjava.emb.integration
org.commonjava.freeki
org.commonjava.maven.ext
org.conbere
org.controlsfx
org.conventionsframework
org.coosproject.build-tools
org.criticalsection.maven
org.cryptoclassloader
org.daisy.maven
org.dbist
org.dellroad
org.dihedron.activities
org.dihedron.crypto
org.dmilne
org.drools.solver
org.dspace.xmlui.cocoon
org.dspace.xmlui.jakarta
org.dspace.xmlui.javac
org.dspace.xmlui.xml
org.echocat.jomon.demo
org.echocat.jomon.maven
org.echocat.jomon.spring
org.eclipse.cdt
org.eclipse.core.runtime.compatibility
org.eclipse.ecf.example
org.eclipse.equinox.jmx.client
org.eclipse.equinox.jmx.server
org.eclipse.jdt.doc
org.eclipse.jetty.fcgi
org.eclipse.jetty.toolchain.setuid
org.eclipse.mylar.bugzilla
org.eclipse.mylar.context
org.eclipse.mylar.jira
org.eclipse.mylar.trac
org.eclipse.platform.doc
org.eclipse.plugins
org.eclipse.uml2.uml.ecore
org.eclipse.uml2.uml.profile
org.eclipse.update.core
org.enumerable
org.eobjects.datacleaner.extensions
org.exoplatform
org.exoplatform.ecm
org.exoplatform.ecm.wcm
org.exoplatform.portletcontainer
org.exoplatform.sample.release
org.expressme
org.firepick
org.fitnesse.plugins
org.floggy
org.fortasoft
org.freckler
org.fusesource.fabric.itests
org.fusesource.fabric.samples
org.fusesource.fabric.virt
org.fusesource.fabric.virt.bundles
org.gaixie.jibu.itest
org.gatein
org.gatein.integration
org.geotoolkit.demo
org.github.leshan
org.glassfish.grizzly.osgi
org.glassfish.jdbc
org.glassfish.jersey.bundles
org.glassfish.main.diagnostics
org.glassfish.main.web.web-embed
org.glassfish.provider
org.glyptodon.guacamole
org.gperfutils
org.greencheek.related.plugins
org.greencheek.spray
org.grooscript
org.gwtbootstrap3
org.hashtree.stringmetric
org.hibernate.beanvalidation.tck
org.hibernate.jpql
org.hornetq.examples.jms
org.htrace
org.htuple
org.icechamps
org.immutant
org.infinispan.arquillian.container
org.ioke
org.jadira.bindings
org.jamel.dbf
org.jasig.portlet.datalist
org.jasig.portlet.notification
org.jasig.service.persondir
org.jasig.ssp.service.persondir
org.javamoney
org.javaswift
org.jberet
org.jberet.test-apps
org.jboss.aerogear.archetypes
org.jboss.aerogear.unifiedpush
org.jboss.arquillian.packager
org.jboss.as.plugins
org.jboss.dna.examples
org.jboss.ejb3.nointerface
org.jboss.ejb3.proxy
org.jboss.ejb3.servitor
org.jboss.elasticsearch
org.jboss.forge.descriptors
org.jboss.forge.roaster
org.jboss.jaxr
org.jboss.narayana.blacktie.plugins
org.jboss.narayana.jta
org.jboss.osgi.common
org.jboss.osgi.distribution
org.jboss.osgi.provision
org.jboss.osgi.testsuite
org.jboss.osgi.webapp
org.jboss.overlord.dependencies.org.eclipse.emf
org.jboss.portletbridge.testing.pluto
org.jboss.pressgang
org.jboss.pressgang.ccms.contentspec
org.jboss.seam.examples-ee6.excel
org.jboss.seam.remoting
org.jboss.seam.spring
org.jboss.seam.xml
org.jboss.soa.bpel.console
org.jboss.spring.archetypes
org.jboss.teiid.connectors.sandbox
org.jboss.tmpdpl
org.jboss.tools.tycho-plugins
org.jboss.weld.examples.jsf.translator
org.jboss.weld.examples.se
org.jboss.xml.registry
org.jbundle.javafx.example
org.jbundle.thin.app
org.jcommons
org.jdeferred
org.jdtaus.maven.skins
org.jdtaus.mojo
org.jenkins-ci.main.maven
org.jframework
org.jhades
org.jibx.config.osgi.wrapped
org.jibx.schema.org.opentravel._2011A.test
org.jibx.schema.org.opentravel._2011B.test
org.jibx.schema.org.opentravel._2012A.test
org.jibx.schema.org.opentravel._2012B.test
org.jibx.schema.org.opentravel._2013A.test
org.jibx.schema.org.opentravel._2013B.test
org.jibx.test.examples
org.jledit
org.jmmo
org.jmockit
org.jodreports
org.jsefa
org.jsense
org.julienrf
org.jumpmind.symmetric.jdbc
org.jvnet.hifaces
org.jvnet.hudson.plugins.findbugs
org.jvnet.hudson.plugins.m2release
org.jvnet.poormans-installer
org.kasource.kajmx
org.kevoree.log
org.kohsuke.ajaxterm4j
org.kuali.pom
org.kualigan.kuali
org.lafros
org.linuxstuff.maven
org.logback-extensions
org.makumba
org.mapfish.print
org.mapstruct
org.marketcetera.fork
org.metawidget.modules.gwt
org.metawidget.modules.hibernate
org.metawidget.modules.json
org.metawidget.modules.spring
org.metawidget.modules.static.faces
org.metawidget.modules.struts
org.metawidget.modules.vaadin
org.mobicents.media.docs
org.mobicents.protocols.sctp.docs
org.mobicents.protocols.ss7.isup.docs
org.mobicents.protocols.ss7.mtp.docs
org.mobicents.protocols.ss7.sccp.docs
org.mobicents.protocols.ss7.sgw
org.mobicents.servers.jainslee.enablers.sip.example
org.mobicents.servers.jainslee.enablers.xdm.example
org.mortbay.jasper
org.mortbay.jetty.alpn
org.mortbay.jetty.archetype
org.mybatis.maven
org.nakedobjects.developers
org.nakedobjects.maven
org.neo4j.server.plugin
org.netpreserve.commons
org.nuiton.matrix
org.nuxeo.cm
org.nuxeo.dam
org.nuxeo.ecm.social
org.objectledge.maven.connectors.ckpackager
org.objectledge.maven.connectors.coral
org.objectledge.maven.connectors.javacc
org.objectledge.maven.connectors.jflex
org.objectledge.maven.connectors.jsc
org.objectledge.maven.connectors.scm
org.objectledge.maven.plugins
org.objectweb.bonita
org.objectweb.fractal.fraclet.java.examples
org.objectweb.fractal.fractaladl.juliac.julia-mixed
org.objectweb.fractal.julia.tests
org.objectweb.fractal.juliac.examples.ultra-merge
org.objectweb.telosys
org.ocpsoft.redoculous
org.onehippo.ecm.hst
org.onehippo.ecm.hst.testsuite.sandbox
org.openengsb.branding
org.openengsb.framework.edb
org.openengsb.framework.workflow
org.openengsb.tooling.pluginsuite
org.openinstaller
org.openqa.selenium.webdriver
org.openstates
org.openxdm.xcap
org.opoo.press
org.opoo.press.maven.wagon
org.ops4j.pax.carrot.samples
org.ops4j.pax.swissbox.samples
org.ops4j.pax.wicket.samples.ds
org.ops4j.pax.wicket.samples.edge.inheritinjection
org.ops4j.pax.wicket.spi
org.osgilab.bundles
org.osiam
org.overlord.bam.event-processor-network
org.overturetool.astcreator
org.overturetool.build
org.overturetool.core.combinatorialtesting
org.overturetool.core.modelcheckers
org.ow2.chameleon.fuchsia.base.protobuffer
org.ow2.chameleon.fuchsia.base.push
org.ow2.chameleon.rose.atmosphere
org.ow2.chameleon.rose.jsonrpc
org.ow2.chameleon.rose.ws
org.ow2.easybeans.console
org.ow2.fractal.bf.itests
org.ow2.fractal.juliac.dream
org.ow2.frascati.examples.native
org.ow2.jasmine.monitoring.jasmine-monitoring-integration-tests-modules
org.ow2.jonas.assemblies.profiles
org.ow2.jonas.documentation
org.ow2.jonas.jonas-itests-applications-jaxb2
org.ow2.jonas.jonas-itests-applications-jaxws-add
org.ow2.sirocco.apis
org.ow2.util.geo
org.ow2.util.scan
org.ow2.util.security
org.ow2.weblab
org.ow2.xlcloud.xsa.ext.rr
org.owasp.esapi.contrib
org.parceler
org.polyjdbc
org.popperfw
org.powermock.modules
org.pustefixframework.editor
org.qsardb.resolution
org.quattor.maven
org.quilt
org.randombits.supplier
org.rapidpm
org.rawdarkroom
org.rdfhdt
org.reactivestreams
org.redkangaroo.maven.plugins
org.richfaces
org.richfaces.build.resources
org.richfaces.extensions.portletbridge
org.richfaces.ui.common
org.richfaces.ui.core
org.richfaces.ui.dnd
org.richfaces.ui.input
org.richfaces.ui.output
org.richfaces.ui.validator
org.robospock
org.robotninjas.barge
org.rythmengine
org.scalactic
org.scalatestplus
org.scalawag.pickaxe
org.scassandra
org.scf4j
org.scribble.runtime.cli
org.seasar.doma
org.semver
org.sitoolkit.tester
org.slf4s
org.snmp4s
org.softsmithy.devlib
org.soitoolkit.refapps
org.sonatype.appbooter.plexus-platforms
org.sonatype.community
org.sonatype.nexus.testsuite
org.sonatype.sisu.jacksbee
org.sonatype.sisu.recipes
org.spiffyui
org.springframework.flex
org.switchyard.karaf
org.talend.esb.policies
org.talend.esb.sam.service
org.tautua.markdownpapers
org.telosys.starterkits
org.terracotta.api
org.terracotta.demos.pojo
org.terracotta.maven.archetypes
org.terracotta.maven.plugins
org.terracotta.session
org.testium-base
org.testmp
org.testpackage
org.texttest
org.timepedia.chronoscope
org.tinylog
org.tobarsegais
org.tohu
org.truth0
org.tyranid
org.umlatj
org.vectomatic
org.wicketeer
org.wooddog.mavenplugins
org.xaloon.archetype
org.xtend
org.xwiki.contrib
org.zoodb
overtone
ph.samson
pl.oakfusion
pl.panasoft
pl.polidea
pl.sigmapoint
pl.solr.ag
quilt
ru.concerteza.buildnumber
ru.finam
ru.kliniki-online
ru.nikitav.android.archetypes
ru.yandex.cocaine
se.gawell.ktvstore
se.jguru.nazgul.core.algorithms.tree.model
se.jiderhamn
se.skltp.aggregatingservices.clinicalprocess.activityprescription.actoutcome
se.skltp.aggregatingservices.clinicalprocess.healthcond.actoutcome
se.skltp.aggregatingservices.clinicalprocess.logistics.logistics
se.skltp.aggregatingservices.crm.scheduling
se.skltp.tk
se.ugli.durian
se.vgregion.ews-services
se.vgregion.icc
se.vgregion.innovationsslussen
se.vgregion.oppna-program-notessystem
sk.softwave
speexx
surefire
tk.skuro
tr.com.lucidcode
turbine
ua.mobius.media.client
uk.ac.cam.ch.opsin
uk.co.caprica
uk.co.firstzero
uk.co.froot.maven.enforcer
uk.co.jemos.maven.plugins
uk.co.opsb
uk.co.stfo
uk.gov.nationalarchives.pronom
uk.org.feedthecoffers
uk.org.ponder
uk.org.ponder.rsfutil
uk.org.raje.maven.plugins
uk.org.retep.microkernel.web
uk.org.subtrack.imaging
us.bryon
us.hornerscorners.mojo
vdoclet
westhawk
wurfl
wutka
xsddoc
yan
za.co.monadic
com.wesleyhome.johksoftware
com.googlecode.log4jdbc
com.rogiel.httpchannel.captcha
de.sven-jacobs
javax.xml.crypto
me.n4u.sass
net.robertcollins
nz.net.ultraq.jaxb
org.axsl.org.w3c.dom.smil
org.hudsonci.lib
org.jvnet.hudson.hadoop
org.kuali.common.util
org.anadix.domains
net.sf.joesnmp
com.adobe.xmp
com.javax0.aptools
com.javax0.fluflu
org.kasource.commons
org.freedesktop.tango
org.jvnet.staxex
org.schwering
org.codehaus.sonar.common-rules
org.apache.cocoon.sax
org.eclipse.jst.common
org.codehaus.groovy.modules.http-builder
commons-daemon
org.eclipse.ui.navigator
simple-jndi
com.basho.riak
org.compass
net.sourceforge.cssparser
com.explodingpixels
net.sourceforge.argparse4j
org.jboss.spec.javax.xml.ws
com.uwyn
org.metastopheles
org.apache.ws.security
com.google.code.gwtx
edu.umd.cs.mtc
org.apache.log4j
org.eclipse.jdt.junit
org.jyaml
com.beetstra.jutf7
com.sun.xml.parsers
org.apache.cocoon.servlet
org.apache.cayenne.unpublished
com.github.jponge
howl
org.cogroo.jspellbr
org.openqa.selenium.client-drivers
org.jruby.jcodings
com.github.spullara.java
net.sf.beezle.sushi
pl.solr.datamodel
castor
org.apache.struts.xwork
org.eclipse.wst.common.frameworks
pl.pragmatists
com.google.code.svenson
org.httpobjects.test
com.sun.xml.stream.buffer
com.googlecode.xmemcached
com.sun.net.httpserver
org.mod4j.org.antlr
org.jboss.stdio
jmagick
org.mockftpserver
org.mobicents.external.jsr309
commons-email
org.sonatype.plexus.template
net.gleamynode
org.eclipse.ui.views.properties
nl.bitwalker
org.ow2.jonas.jpaas.catalog
com.github.spullara.cli-parser
com.github.sgroschupf
crimson
se.jguru.nazgul.test.bundles.hello.api
abbot
org.mod4j.com.google.inject
org.glassfish.distributions
org.jblas
org.eclipse.gmf.runtime.draw2d
com.almworks.sqlite4java
ehcache
org.jboss.invocation
org.glassfish.main.resourcebase.resources
com.sun.el
commons-betwixt
org.objectweb.fractal.fractalexplorer
org.kohsuke.rngom
com.workplacesystems.utilsj
net.sf.kerner-utils-collections
org.jboss.client
net.sf.jwordnet
org.mobicents.protocols.ss7.scheduler
org.eclipse.jdt.core
org.dnsjava
com.cybozu.labs
org.javatuples
org.coconut.management
com.mtvi.plateng
com.google.code.maven-play-plugin.com.github.branaway.japid
org.httpobjects.servlet
nl.cloudfarming.eventbus
com.io7m.jtensors
com.googlecode.javacpp
activeio
werken-xpath
kxml2
servlets.com
ch.sahits
info.ganglia.gmetric4j
annogen
org.objectweb.deployment
org.ow2.jasmine.jade.fractal.deployment.local
org.ow2.jasmine.jade.fractal.fractalrmi
hessian
com.gmongo
net.sf.kerner-utils-io
nz.net.ultraq.web.filter
org.ow2.util.stream
jexcelapi
org.icepush
com.itextpdf.tool
org.randombits.utils
net.sf.clirr
org.owasp.esapi
org.mod4j.org.eclipse.xtend.util
jung
pircbot
org.apache.maven.artifact
net.sourceforge.javacsv
com.android
com.google.code.jcouchdb
com.googlecode.ehcache-spring-annotations
com.mapvine
xjavadoc
forehead
org.eclipse.core.runtime
com.google.code.java-allocation-instrumenter
midje
org.bluestemsoftware.open.eoa.application.spring
org.ojalgo
soap
com.sun.org.apache.xml.internal
com.sun.xml.dtd-parser
de.plushnikov
de.zeigermann.xml
org.jvnet.annox
com.allen-sauer.gwt.log
com.github.rjeschke
org.gmock
c10n
com.clickconcepts.logging
com.google.code.maven-play-plugin.com.github.yeungda.jcoffeescript
com.google.code.maven-play-plugin.com.google.code.eamelink-mockito
com.google.code.maven-play-plugin.com.kjetland
com.google.code.maven-play-plugin.net.sourceforge.cobertura
com.google.jsilver
com.googlecode.amssupport
com.healthmarketscience.common
com.j2bugzilla
com.spatial4j
com.vektorsoft.demux.core
com.whirlycott
in.yuvi
net.cafeto.entitycopy
net.ftlines.wicket-fullcalendar
net.sf.stax
net.sourceforge.wicketwebbeans.databinder
net.stepniak.api.push
org.acplt
org.anadix.parsers
org.codehaus.mojo.webstart-maven-plugin
org.eclipse.jetty.npn
org.eclipse.swt.wpf.win32
org.fusesource.eca
org.ietf
org.jboss.docs
org.jvnet.hudson.plugins.vss
org.kohsuke.loopy
org.ow2.chameleon.commons.junit
org.ow2.util.cluster
org.pircbotx
net.customware.gwt.dispatch
com.google.code.maven-play-plugin.org.xhtmlrenderer
org.apache.mrunit
javax.jmdns
pdfbox
org.jboss.osgi.metadata
org.cojen
org.bitbucket.bradleysmithllc.json-validator
org.floggy.3rd.org.microemu
org.agilewiki.jid
net.java.dev.laf-plugin
net.java.dev.laf-widget
org.javafunk.matchbox
jcache
org.ow2.util.url
com.unboundid
net.sf.sdedit
org.fluttercode.datafactory
org.eclipse.gmf.tooldef
org.apache.cocoon.controller
org.jibx.schema.net.java
com.googlecode.aic-util
com.svnkit
org.eclipse.jst.j2ee.ejb.annotation
org.mod4j.com.google
gov.nih.imagej
org.eclipse.gmf.runtime.draw2d.ui
com.mycila.xmltool
org.eclipse.gmf.runtime.emf.clipboard
org.eclipse.gmf.runtime.emf.ui
org.core4j
org.mod4j.com.ibm
org.mockejb
com.sun.xml.bind.jaxb
de.flapdoodle.embedmongo
net.sourceforge.fmpp
org.specs
org.mobicents.media.controls
org.junit
org.ow2.util.xml
org.jxta.platform
org.kohsuke.httpunit
com.saucelabs
org.mod4j.org
org.geotools
org.objectweb.dream.dreamannotation
xmlwriter
com.mks.api
sablecc
com.sun.script.jruby
org.fusesource.rrd4j
com.metaparadigm
org.java.net.substance
wss4j
org.ow2.carol.irmi
org.eclipse.uml2.common
org.mobicents.jsr309
org.jscience
org.mobicents.media.hardware
commons-scxml
org.eclipse.ui.intro
org.isomorphism
com.googlecode.functional-collections
net.tanesha.recaptcha4j
com.integralblue
org.openscm.kundo.common
com.gwtincubator
net.java.dev.beansbinding
proxytoys
org.commonjava.emb.infra
org.jboss.spec.javax.servlet.jstl
com.zaubersoftware.commons.repository
com.googlecode.gwt.inject
org.eiichiro.bootleg
org.jvnet.wagon-svn
org.ow2.jonas.jpaas.iaas-manager
org.codehaus.sonar.sslr-squid-bridge
org.eclipse.gmf.bridge
eu.infomas
org.mod4j.org.eclipse.compare
clj-http
com.aphyr
com.atlassian.seraph
com.github.ansell.jjtraveler
com.github.stephenc.findbugs
com.google.code.maven-play-plugin.com.asual.lesscss
com.google.code.maven-play-plugin.com.google.code.morphia
com.google.code.maven-play-plugin.org.playframework.modules.spring
com.googlecode.aic-expresso
com.toedter
dk.brics.automaton
edu.princeton.cup
fr.opensagres.xdocreport.appengine-awt
jdiff
jspapi
lein-midje
me.moocar
net.sf.beezle.mork
net.sf.jfcunit
net.sf.jranges
net.sf.kdgcommons
org.axsl.org.w3c.dom.mathml
org.codehaus.stomp
org.eclipse.ecf.protocol
org.glassfish.branding
org.jvnet.its
org.objectledge.ckpackager
org.objectweb.zeus
pl.clareo.coroutines.user
tw.edu.ntu.csie
com.googlecode.disruptor
com.google.code.plsqlgateway
net.sf.xsltmp
net.sourceforge.csparsej
village
net.sourceforge.pjl-comp-filter
org.ow2.fastrmic
com.damnhandy
org.eclipse.ui.ide
org.jvnet.jaxb1.maven2
com.eaio.uuid
org.fusesource
com.github.stephenc.eaio-uuid
com.mortennobel
org.criticalsection.commons-exec
org.ow2.fractal.julia
org.codehaus.cake.management
org.codehaus.cake.util
org.eclipse.gmf.runtime.diagram.ui.resources
jug
com.devbliss.doctest
org.powermock.api
org.mod4j.org.eclipse.ui.workbench
org.apache.cocoon.rest
be.cyberelf.nanoxml
org.openspml
com.google.code.gwt-log
jcs
jython
jdsl
pull-parser
com.io7m.jspatial.core
net.sourceforge.expectj
org.eclipse.uml2.codegen
org.wildfly.security
org.eclipse.mylyn.resources
org.sonatype.appbooter
org.eclipse.gmf.runtime.gef
org.mod4j.org.eclipse.xtend.typesystem
org.apache.jcs
org.fusesource.joram-jms-tests
de.abelssoft
org.devlib.schmidt
odmg
ecs
org.codenarc
org.spearce
org.jboss.maven.util
net.java.dev.jintention
fastutil
org.eclipse.wst.web
org.kuali.db.ojb
org.eclipse.ltk.ui
org.eclipse.mylyn.github
ws-commons-util
org.codehaus.jra
com.android.prefs
com.github.groovy-wslite
com.github.jeluard.ion
com.google.code.maven-play-plugin.org.playframework.modules.japid
com.googlecode.efficient-java-matrix-library
com.googlecode.fmpp-maven-plugin
com.googlecode.plist
com.io7m.jlog
com.jayway.facebooktestjavaapi
com.kitfox.svg
com.novell.ldap
com.owtelse.codec
com.sun.bigbrother
com.wombatnation
de.akquinet.gomobile.android.rindirect
net.dataforte.cassandra
net.glxn
net.lingala.zip4j
net.sf.bioutils.proteomics
net.sf.kerner-utils
nz.net.ultraq.postprocessing
org.codemonkey.javareflection
org.criticalsection.mtn4java
org.ddogleg
org.eclipse.ecf.telephony
org.georegression
org.osframework.testng
org.ow2.weblab.services
org.sonatype.nexus.ruby
org.timepedia.exporter
org.yamj
se.mockachino
swank-clojure
org.objectweb.lewys
com.google.code.maven-play-plugin.net.sf.jtidy
net.sf.twip
com.ctc.wstx
org.mod4j.org.eclipse.jdt
janino
net.sf.flexjson
mx.bigdata.anyobject
net.java.dev.jsr-275
com.fasterxml.uuid
com.3levers.cssselectors
net.sf.squirrel-sql.thirdparty.non-maven
org.eclipse.gmf.runtime.common.ui.action
com.sun.jersey.test.framework
com.googlecode.charts4j
org.eclipse.emf.commonj
net.java.dev.inflector
org.mobicents.protocols.mgcp
org.iq80.snappy
org.hibernate.common
com.github.sommeri
burlap
org.hudsonci.plugins.findbugs
nz.net.ultraq.web.thymeleaf
org.etsi.uri.gcm
org.fedorahosted.openprops
compojure
org.jboss.test-audit
dbunit
org.java-sql-generator.api
org.uispec4j
net.sf.jbg
com.ecyrd.speed4j
org.hibernate.apache.lucene.solr
org.postgresql
com.android.tools.ddms
org.objectweb.fractal.fractaladl.dumper
org.objectweb.util.explorer.plugins
org.objectweb.jonas.tools
com.101tec
org.eclipse.gmf.map
org.ow2.jonas.jpaas.jpaas-manager-api
net.sf.xslthl
com.github.gwtbootstrap
co.freeside
com.cognifide.securecq
com.googlecode.gstreamer-java
com.googlecode.gwt-crypto
com.googlecode.jtype
com.googlecode.slf4j-maven-plugin-log
net.peachjean.pegdown.uml
net.sf.cotta.core
net.sf.marineapi
org.agilewiki.jasocket
org.agilewiki.jfile
org.apache.juddi.scout
org.cip4.lib.xjdf
org.eclipse.equinox.jsp.jasper
org.gridkit.coherence.utils
org.jboss.spec.javax.xml.registry
org.kohsuke.sfx4j
org.ow2.easybeans.utils
org.wikimodel
org.wiztools.commons
com.sun.akuma
it.could
com.exadel.flamingo.flex
art.uniroma2.it.org.openrdf.sesame
org.objectstyle.ashwood
activecluster
org.eclipse.gmf.runtime.diagram.ui.providers
org.eclipse.gmf.runtime.diagram.ui.resources.editor
commons-transaction
com.squeakysand.schema.javaee
dk.eobjects.commons
juel
org.fusesource.commonman
com.linkedin.kamikaze
org.ow2.jonas.wrapper
org.codehaus.spring-security-oauth
org.dspace.dnsjava
org.extremecomponents
net.sourceforge.barbecue
com.umlet
org.sourceforge.jlibeps
org.jboss.spec.javax.enterprise.deploy
org.springframework.retry
org.sonatype.grrrowl
com.sun.solaris
org.jvnet.libzfs
org.jvnet.winp
strutstestcase
com.google.code.maven-scm-provider-svnjava
org.deephacks.cached
com.groupon.roboremote
com.metapossum
com.michelboudreau
com.mysema.spring
com.nectify
com.surftools
de.congrace
de.drni.bananasplit
dynaop
edu.cmu.lti.oaqa.bio.core
edu.cmu.lti.oaqa.core.provider
edu.cmu.lti.oaqa.framework.impl
itext
jmimemagic
net.sf.epsgraphics
net.sf.jni-inchi
net.sf.jsog
net.sourceforge.jseq
org.im4java
org.jboss.jreadline
org.littlegrid
org.nanocontainer.nanowar
org.seleniumhq.selenium.core
org.wikiclean
pcj
el-impl
org.ow2.util.substitution
dwr
com.sun.grizzly.scripting
org.eclipse.emf.ecore.change
org.iq80.cli
org.cdmckay.coffeedom
jgrapht
org.mod4j.org.eclipse.xtext.ui
com.sonyericsson.hudson.plugins.rebuild
backport175
org.w3c.jigsaw
com.linuxense
org.eclipse.gmf.runtime.draw2d.ui.render
org.eclipse.jst.jsf.common
org.eclipse.wst.common.ui
edu.mit
javatar
org.apache.cocoon.monitoring
org.apache.cocoon.optional
org.apache.cocoon.profiling
org.apache.cocoon.stringtemplate
org.apache.cocoon.wicket
com.fiestacabin.dropwizard.guice
com.google.code.maven-play-plugin.com.sienaproject.siena
com.google.code.maven-play-plugin.org.apache.ddlutils
com.hamburgsud.log4testing
com.offbytwo.class-finder
com.projectdarkstar.ext.jeffpk
com.stevesoft.pat
gr.spinellis
me.raynes
net.sf.jbg.mojo
net.sf.mmax2
org.bluestemsoftware.open.eoa.shared
org.codeartisans.asadmin-java
org.eclipse.ecf.filetransfer
org.httpobjects.freemarker
org.jbibtex
org.jmathml
org.ow2.weblab.components.content.webdav
org.sedris
org.timen
uispec4j
easyconf
org.fusesource.jdbm
org.codegist
uk.ltd.getahead
com.taobao.gecko
org.textmining
org.objectweb.dream.dreamlib
net.smartlab.config
com.android.ddmlib
org.jpatterns
uk.co.jemos.podam
au.net.ocean.ext
com.cloudbees.aether
com.google.code.p.arat
com.thetus.build
jarjar
net.greghaines
net.sf.antenna
org.bitbucket.bradleysmithllc.webserviceshubclient
org.dynjs
org.gnu.inet
org.kohsuke.jetbrains
org.ow2.sirocco
org.pietschy
org.projectodd.rephract
org.scalaforge
org.simplericity.macify
org.sonatype.reflect
prevayler
com.sun.media
org.netbeans.lib
pl.net.bluesoft
org.eclipse.jetty.drafts
org.xmlmatchers
com.googlecode.cernunnos
org.springframework.hateoas
org.apache.mesos
org.eclipse.jst.ejb
com.sun.tools.ws
generama
com.googlecode.gentyref
org.tynamo.gae
org.apache.ws.commons.neethi
org.reddwarfserver.ext.berkeleydb
com.addthis.metrics
com.capgemini.platina.maven.release
com.fallabs
com.owlike
com.vmware
com.xebialabs.cloud
de.jbellmann.junit
gnu-regexp
org.dspace.dependencies.jmockit
org.maltparser
org.modelmapper
org.testatoo.core
org.commonjava.cdi.util
org.jboss.spec.javax.xml.bind
org.kuali.student.admin
sslext
jrms
com.juhuasuan
securityfilter
net.coobird
org.eclipse.jst.pagedesigner.jsp
com.googlecode.lesscss4j
it.javalinux.sibilla
net.sourceforge.mikha-utils
nl.javadude.assumeng
org.coosproject.extender
org.jboss.jdf
org.jboss.security.web
org.jboss.spec.javax.management.j2ee
org.rrd4j
se.jguru.nazgul.core.persistence.model
se.jguru.nazgul.core.xmlbinding.spi.jaxb
se.jguru.nazgul.test.xmlbinding
com.googlecode.aviator
org.eclipse.gmf.bridge.ui
org.eclipse.gmf.graphdef.codegen
org.mnode.juicer
com.bmsi
net.java.dev.textile-j
org.jboss.spec.javax.rmi
com.tonicsystems
com.btmatthews.utils
com.googlecode.htmlcompressor
com.memetix
edu.ucla.cs.compilers
javax.sdp
net.authorize
net.sf.jcgrid
org.atmosphere.plugins
org.gaixie.json
org.jfarcand
org.jruby.joni
org.nuxeo.common
ru.zinin
org.mobicents.external.tritonus
org.dspace.dependencies.cocoon
cc.mallet
org.hibernate.java-persistence
com.github.epabst.triangle
com.googlecode.protobuf-java-format
net.sf.jpathwatch
net.sf.oqt
org.jboss.el
org.perfidix
org.robobinding
com.github.detro.ghostdriver
org.mobicents.shrinkwrap.container
com.googlecode.cqengine
com.google.code.google-collections
com.googlecode.hs4j
com.metaweb
cz.muni.fi.mir
de.lightful.maven.drools
javainetlocator
org.apache.cocoon.stax
org.codehaus.javancss
org.jmeld
org.ow2.util.execution
org.tukaani
org.mobicents.protocols.ss7.congestion
org.eclipse.jst.servlet
directory-network
jdbm
org.jboss.transaction
com.adenki
com.famfamfam
com.googlecode.ictclas4j
ical4j
net.sourceforge.segment
org.eclipse.ecf.discovery
org.hibernate.jsr303.tck
org.scannotation
org.lazyluke
cobertura
com.googlecode.shutdown-listener
commons-grant
jboss.messaging
net.sf.sit
net.sourceforge.zip64file
org.openengsb.ui.common
thaiopensource
org.jboss.service.binding
org.ajaxtags
com.google.code.maven-play-plugin.org.apache.hbase
org.drizzle.jdbc
org.idevlab
net.sf.groovydice
org.codeartisans.qipki.qipki-clients
org.floggy.3rd.org.eclipse.jdt
org.java-sql-generator.implementation
org.outerj.xreporter
yom
clojure-jsr223
com.projectdarkstar.ext.fenggui
com.projectdarkstar.ext.jorbis
au.com.flyingkite
ch.acra
gov.loc
net.dataforte
org.jdtaus.banking.dtaus
org.jdtaus.core.text
org.jvnet.hudson.winstone
taglibrarydoc
net.jpountz.lz4
me.lemire.integercompression
net.engio
net.sf.jgrapht
it.tidalwave.vaadin
javax.security
org.jboss.osgi.testing
se.vgregion.icc.sd.portal
org.objectweb.tribe
com.googlecode.jatl
com.incors
com.jtattoo
com.mgmtp.gcviewer
net.sf.nimrod
net.sf.tinylaf
lingo
com.jgeppert.struts2.bootstrap
org.jcrom
org.meruvian.inca.s2restplugins
velocity-dvsl
com.seaglasslookandfeel
org.eclipse.jst.j2ee.navigator
org.eclipse.mylyn.java
org.eclipse.jst.j2ee.webservice
org.jboss.reloaded.naming
org.jboss.spec.javax.xml.soap
com.ning.jaxrs
org.jboss.ejb3.sis
javacc
org.andromda.bootstrap.cartridges
org.eclipse.gmf.runtime.diagram.ui.printing
org.eclipse.jst.j2ee.jca
com.bluelock
com.google.code.crawler-commons
org.eobjects.sassyreader
jmdns
org.jongo
com.google.code.maven-play-plugin.org.apache.thrift
org.apache.servicemix.document
apache-velocity
org.sakaiproject.mock
org.jszip.gems
org.sonatype.spice.zapper
org.ops4j.pax.wicket.samples.model
org.apache.camel.tests
org.apache.servicemix.platform.testing
org.iso_relax.verifier.jaxp.validation
jsch
org.fontbox
org.eclipse.core.databinding
adarwin
adgoji
aelfred
aero.m-click
agallego
aislib
alembic
aleph
am.ik.ltsv4j
am.ik.marked4j
analyze
ant-doxygen
anttex
apache
apache-log4cxx.contrib
approximate-policy-iterajion
aptconvert
ar.com.fdvs
ar.com.hjg
ar.com.jmfsg
ashkay
ashkelon
asia.ivity
at.ait.dme.forcelayout
at.ff-esternberg.sybos
at.irian.typescript
at.salzburgresearch.nodekeeper
atlassian-core
atlassian-profiling
au.com.alderaan
au.com.clearboxsystems.maven.plugins.nodejs
au.com.datasymphony
au.com.ish.gradle
au.com.nicta
au.com.permeance
au.com.redboxresearchdata.fascinator
au.com.refactor.groovy
au.com.refactor.texttable
au.net.causal.maven.native-security
au.net.causal.maven.plugins
au.net.ocean
avalon-cornerstone
azote
bacure
be.billington.calendar.recurrencepicker
be.hikage.maven.plugins
be.idamediafoundry.sofa
be.jacobsvanroy
be.mjosoft
be.objectify
be.pixxis
be.redlab.jersey
be.redlab.logback
be.redlab.testhelpers
be.roam.hue
be.selckin.util
be.thinkerit.gradle
biz.freshcode.b-generation
biz.futureware.mantis
biz.neustar.maven.plugins
biz.paluch.logging
biz.paluch.maven.configurator
blackwater
blex
blissed
boxstuff
br.com.caelum.seleniumdsl
br.com.digilabs.jqplot
br.com.ingenieux.cedarhero
br.com.ingenieux.hadoop
br.com.ingenieux.simplejpa
br.com.jslsolucoes
br.com.otavio
br.com.otavio.vraptor.archetypes
br.com.postmon
br.com.progolden
br.com.summa
br.com.triadworks
br.entities
by.stub
byte-streams
ca.coglinc
ca.gobits.bnf
ca.grimoire.jsp
ca.grimoire.spring
ca.jimr
ca.odell
ca.redtoad
ca.svarb
ca.ucalgary.ispia
ca.umontreal.iro
calabash
camel-snake-kebab
cantor
caribou
cascalog
casyn
cc.abstra.pasilla
cc.artifice
cc.ivory
cc.plural
cc.wikitools
cewolf
ch.aonyx.broker.ib
ch.bind
ch.dkitc
ch.ethz.origo
ch.fortysix
ch.hsr
ch.imvs
ch.inftec.test
ch.iterate.openstack
ch.ledcom.agent.jmx
ch.ledcom.maven
ch.ledcom.tomcat.interceptors
ch.ledcom.tomcat.valves
ch.marcus-schulte.maven
ch.mfrey.thymeleaf.extras.cache
ch.mfrey.thymeleaf.extras.with
ch.mimo
ch.miranet.commons
ch.nerdin
ch.qos.cal10n.plugins
ch.raffael.pegdown-doclet
ch.ringler.tools
ch.rotscher.maven.core
ch.semafor
ch.sf.htt
ch.shamu
ch.simas.qlrm
ch.simas.sqlresultmapper
ch.uzh.ifi.ddis
ch.uzh.ifi.ddis.hadoop
ch.uzh.ifi.ddis.ifp.esper
charlotte
chee
circleci
cl.alma.camel.acs
classlojure
clauth
claw
clip-test
clirr
clj-assorted-utils
clj-avro
clj-blocks
clj-cassandra
clj-diffmatchpatch
clj-esearch
clj-exchange
clj-fix
clj-ftp
clj-hector
clj-imajine
clj-jade
clj-log
clj-mail
clj-obt
clj-obt-service
clj-pdf
clj-rpc
clj-simple-form
clj-soap
clj-spawner
clj-ssh
clj-sslbs
clj-stackdriver
clj-twilio
clj-webdriver
clj-zoo-service-tracker
clj-zoo-watcher
clj.monitor
cljs-hash
cljs-ring-remotes
cljsbuild
clojail
clojax
clojure-hadoop
clojure-mercator-projection
clojure-protobuf
clojure-python
clojure-tools
clojure-watch
clojurefx
clojush
clomponents
closure-templates-clj
cludje
cn.baiweigang
cn.guoyukun.jasst
cn.jpush.api
cn.org.rapid
cn.org.zeronote
cn.shenyanchao.ut
cn.trinea.android.view.autoscrollviewpager
cn.wanghaomiao
co.bitcode.utils
co.diji
co.kr.itwise
co.leantechniques
co.mewf.sqlwriter
co.nstant.in
co.ntier
co.ntier.mongo
co.pishfa.accelerate
co.stateful
co.tomlee.gradle.plugins
co.torri
code.google.com
code316
codox
com.aamend.hadoop
com.aconex.scrutineer
com.acquitygroup.demandware
com.activecq.api
com.activecq.tools.quickimage
com.activequant
com.adamlewis
com.adaptivui
com.adobe.granite
com.adobe.granite.maven
com.adobe.pdf
com.aerospike
com.aestasit.infrastructure.mock
com.aestasit.infrastructure.puppet
com.agiliumlabs.arquillian
com.agiliumlabs.osxappbundle
com.agoragames
com.ajjpj.a-base
com.ajjpj.a-mapper
com.ajjpj.a-sysmon
com.akathist.maven.plugins.launch4j
com.alexecollins
com.alexecollins.maven.plugin
com.alexkasko
com.alexkasko.maven
com.alexkasko.netty
com.alexkasko.rest
com.alexkasko.tasks
com.alexkasko.unsafe
com.alexnederlof
com.alibaba.asyncload
com.alibaba.citrus.sample
com.alibaba.cobar
com.alibaba.druid
com.alibaba.ons
com.alibaba.tamper
com.alienff
com.aliyun.openservices
com.allanditzel
com.allen-sauer.gwt.voices
com.allogy.json
com.allogy.maven.wagon
com.allsparkcube
com.almworks.jira.structure
com.alogient.cameleon.java.extension
com.alvazan
com.amashchenko.maven.plugin
com.amashchenko.struts2.actionflow
com.amazonaws.s3
com.amplitude
com.andraskindler.quickscroll
com.andrearichiardi.android
com.andrewkroh.gradle
com.andrewreitz
com.andrewreitz.bad
com.andrewreitz.velcro
com.andrewswan
com.android.tools.external.lombok
com.android.tools.layoutlib
com.android.tools.lint.checks
com.aneeshpu.dbdeppop
com.anjlab.android.iab.v3
com.antelink.reporter.jenkins.plugin
com.anthavio
com.antiaction
com.antwerkz.github
com.app55
com.apphance.ameba
com.apphance.flow
com.apruve
com.aquafx-project
com.aranea-apps.android.demo
com.arcao
com.arcbees.appengine
com.arcbees.facebook
com.arcbees.gaestudio
com.arcbees.gquery
com.arcbees.stripe
com.arnaudpiroelle
com.arusarka
com.assaydepot
com.assemblade.cat
com.atlascopco
com.atlassian.annotations
com.atlassian.aws
com.atlassian.bamboo.distribution
com.atlassian.bamboo.gadgets
com.atlassian.bamboo.plugins.ant
com.atlassian.bamboo.plugins.brokenbuildtracker
com.atlassian.bamboo.plugins.buildnumberstamper
com.atlassian.bamboo.plugins.compatibilitytask
com.atlassian.bamboo.plugins.dotnet
com.atlassian.bamboo.plugins.dummytask
com.atlassian.bamboo.plugins.findbugs
com.atlassian.bamboo.plugins.fisheyecommitviewer
com.atlassian.bamboo.plugins.gotobar
com.atlassian.bamboo.plugins.jira
com.atlassian.bamboo.plugins.labeller
com.atlassian.bamboo.plugins.maven
com.atlassian.bamboo.plugins.php
com.atlassian.bamboo.plugins.repository
com.atlassian.bamboo.plugins.scripttask
com.atlassian.bamboo.plugins.stashcommitviewer
com.atlassian.bamboo.plugins.testresultparser
com.atlassian.bamboo.plugins.tomcat
com.atlassian.bamboo.plugins.triggercondition
com.atlassian.bamboo.plugins.variable.updater
com.atlassian.bamboo.plugins.vcs
com.atlassian.bamboo.plugins.xcode
com.atlassian.bandana
com.atlassian.botocss
com.atlassian.confluence.extra.email
com.atlassian.confluence.extra.impresence2
com.atlassian.confluence.extra.invite
com.atlassian.confluence.extra.paste
com.atlassian.confluence.extra.rsvp
com.atlassian.confluence.extra.tinymceplugin
com.atlassian.confluence.extra.webdav
com.atlassian.confluence.extra.widgetconnector
com.atlassian.confluence.extras
com.atlassian.confluence.keyboardshortcuts
com.atlassian.confluence.maven.plugins
com.atlassian.confluence.plugin.gradient
com.atlassian.confluence.plugin.threaddump
com.atlassian.confluence.plugins.crucible
com.atlassian.confluence.plugins.editor
com.atlassian.confluence.plugins.jira
com.atlassian.confluence.plugins.socialbookmarking
com.atlassian.confluence.plugins.xmlrpc.bloggingrpc
com.atlassian.confluence.poll
com.atlassian.confluence.rest
com.atlassian.confluence.sal
com.atlassian.confluence.themes.clickr
com.atlassian.confluence.tinymceplugin
com.atlassian.confluence.whatsnew
com.atlassian.core
com.atlassian.cpji
com.atlassian.crowd.client
com.atlassian.crowd.distribution
com.atlassian.cviz
com.atlassian.devrel
com.atlassian.docco
com.atlassian.dummy
com.atlassian.event
com.atlassian.ext
com.atlassian.fage
com.atlassian.fecru.plugin.review-issue-transition
com.atlassian.fecru.plugins
com.atlassian.fedex.jroper
com.atlassian.fugue
com.atlassian.functest
com.atlassian.gzipfilter
com.atlassian.healthcheck
com.atlassian.hibernate
com.atlassian.image
com.atlassian.inception
com.atlassian.inject
com.atlassian.instant
com.atlassian.jgitflow
com.atlassian.jira.ext.bucket
com.atlassian.jira.ext.charting
com.atlassian.jira.extra
com.atlassian.jira.plugin
com.atlassian.jira.plugin.ext.subversion
com.atlassian.jira.plugins.workflow.sharing
com.atlassian.jira.toolkit
com.atlassian.jira.whatsnew
com.atlassian.jirabuildmonitor
com.atlassian.labs.httpservice
com.atlassian.ldap
com.atlassian.lesscss
com.atlassian.lucene.stats
com.atlassian.mail
com.atlassian.maven.plugins.testharness
com.atlassian.modzdetector
com.atlassian.nailgun
com.atlassian.navigator
com.atlassian.ondemand.backupmanager
com.atlassian.ondemand.migrator
com.atlassian.osuser
com.atlassian.p4package
com.atlassian.peace
com.atlassian.plugins.editor
com.atlassian.plugins.helptips
com.atlassian.plugins.test.rpc
com.atlassian.plugins.velocitytest
com.atlassian.pocketknife
com.atlassian.prettyurls
com.atlassian.profiling
com.atlassian.renderer
com.atlassian.rpc
com.atlassian.sandbox.bamboo
com.atlassian.scheduler
com.atlassian.shipit
com.atlassian.soy
com.atlassian.trackback
com.atlassian.tunnel
com.atlassian.usercompatibility
com.atlassian.util.concurrent
com.atlassian.utils
com.atlassian.uwc
com.atlassian.velocity.htmlsafe
com.atlassian.xwork
com.autoscout24.gradle
com.autsia.bracer
com.axiomalaska
com.azurenight.maven
com.azwul.api
com.baasbox
com.bacoder.box
com.badlogicgames.box2dlights
com.badlogicgames.jlayer
com.badlogicgames.packr
com.bah.jmockit
com.bah.jmockit.com.googlecode.jmockit
com.bah.lucene
com.bahmanm
com.balancedpayments
com.baloise.maven
com.barchart.base
com.base2art
com.base2services.jenkins
com.basho.riak.hadoop
com.basho.riak.protobuf
com.bazaarvoice
com.bazaarvoice.cms
com.bazaarvoice.jackson
com.bazaarvoice.jsonpps
com.bazoud.elasticsearch
com.bazoud.metrics
com.beachape.metascraper
com.beacon50
com.bealetech
com.belteshazzar
com.benmccann
com.betfair.platform
com.betfair.plugins
com.blendlabsinc
com.blogspot.ctasada.gwt-eureka
com.blogspot.geekabyte.jprowork
com.bluetrainsoftware
com.bluetrainsoftware.bathe
com.bluetrainsoftware.common
com.boivie
com.bookegou
com.botplatform
com.boundary
com.box20six
com.bradleydwyer
com.bradrydzewski
com.braintreepayments.gateway
com.brewinapps
com.brightcove.metrics
com.brightcove.zencoder.api
com.britesnow
com.bryghts.kissdata
com.bryghts.kissjson
com.bryghts.kissmx
com.bryghts.kissnumber
com.btaz.datautil
com.btaz.util
com.btmatthews.hamcrest
com.btmatthews.jaxb2_commons
com.btmatthews.junit
com.btmatthews.ldapunit
com.btmatthews.maven.plugins.inmemdb
com.btmatthews.mojo
com.btmatthews.selenium.junit4
com.buildcoin.plugins.jenkins
com.bungleton
com.buschmais.jqassistant.maven
com.buschmais.jqassistant.test
com.cakupan
com.canoo
com.capgemini.oss.maven.master
com.capgemini.platina
com.caringo.client
com.carmanconsulting.hibiscus
com.carmatechnologies.cassandra
com.carmatechnologies.commons
com.carrotgarden.base
com.carrotgarden.jwrapper
com.carrotgarden.nexus
com.caverock
com.ccbill
com.cedarsoft.commons.swing-presenter
com.cedarsoft.hudson
com.ceilfors.maven.plugin
com.cflewis.hudson.jdepend
com.cgbystrom
com.change_vision.astah
com.chargebee
com.chillerlabs
com.chilmers.config-bootstrapper
com.chiradip.rediscl
com.chrylis
com.ciaranwood
com.citytechinc.maven.plugins
com.cj.jshintmojo
com.cj.qunit.mojo
com.ckeditor
com.clashinspector
com.classactionpl.tz
com.clearspring
com.clearspring.analytics
com.clebert.jlingua
com.clever-age
com.clickconcepts.geb
com.clickconcepts.jira
com.clickconcepts.junit
com.clickconcepts.project
com.clickconcepts.spock
com.closure-sys
com.cloudbees.event
com.cloudbees.extras
com.cloudbees.maven.plugins
com.cloudbees.mtslaves
com.cloudera.cdh
com.cloudera.cdk
com.cloudera.flume.plugin
com.cloudera.itest
com.cloudesire
com.cloudfoundry.tothought
com.cloudsponge
com.cloutree
com.coalmine
com.cocosw.framework
com.cocosw.query
com.code54.mojo
com.code972
com.codeminer42
com.codeplex.jpa4azure
com.codinguser.android
com.cognifide.maven.plugins
com.coherentlogic.coherent
com.coherentlogic.coherent.data-model
com.collabnet.labmanagement.api
com.comcast
com.commsen
com.comsysto.buildlight
com.confluex.mule
com.connectifier.xero
com.connorgarvey.gradle
com.contaazul
com.contentjon
com.contrastsecurity
com.cooldatasoft
com.coravy.hudson.plugins.github
com.coroptis.cubiculus
com.corundumstudio.socketio
com.cosmicpush
com.couchbase.client
com.countvajhula
com.coverity.security
com.crawljax.plugins.archetypes
com.createsend
com.creativewidgetworks
com.crygier
com.ctrlplusz
com.custardsource
com.cuubez
com.cyrusinnovation.computation-engine
com.danhaywood.java
com.danielfariati
com.dasberg.maven.plugins
com.datasift.client
com.datastax.wikitext
com.daveoxley.cbus
com.davidkarlsen.commonstransaction.spring
com.dbtsai.lbfgs
com.dekayd
com.denormans.google-analytics-gwt
com.depmesh
com.despegar.maven.plugin
com.detectlanguage
com.devbliss.risotto
com.devspan.mojo.javascript
com.devspan.vendor.jquery
com.dgwave.car
com.digitalbarista
com.digitalpebble.textclassification
com.digitalpetri.opcua
com.digitalreasoning.herman
com.digitalreasoning.sdp
com.dinstone.ut
com.directmyfile
com.discoverydns
com.discoverydns.dnsapi
com.discursive.cas.extend
com.discursive.dao.generic
com.discursive.maven
com.discursive.taglib.prototype
com.discursive.taglib.reference
com.discursive.wicket.media
com.dkirrane.groovy.gitflow
com.dkirrane.maven.archetype
com.dkirrane.maven.plugins
com.dmurph.mvc
com.doitnext
com.dolby.confluence.net
com.dooapp.XStreamFX
com.doomonafireball.betterpickers
com.dottydingo.hyperion
com.dottydingo.hyperion.module
com.dottydingo.service.endpoint
com.dottydingo.service.pipeline
com.dp4j
com.dreizak
com.dropbox.maven
com.ds.tools.hudson
com.dteoh
com.dubture
com.duowan.android.netroid
com.e-movimento.tinytools
com.eagerlogic.cubee
com.ean.config
com.ean.log
com.ean.mobile
com.ebay
com.ebiznext.sbt.plugins.andromda
com.ebiznext.soapui
com.eclipsesource.minimal-json
com.eclipsesource.tycho.karaf.bridge
com.ecwid
com.ecyrd.simplejmx
com.edb.os
com.edropple.jregex
com.efsavage.jquery
com.efsavage.twitter.bootstrap
com.eincs.build
com.ekuefler.supereventbus
com.elevenware
com.elibom
com.elogiclab.guardbee
com.elusive-code.newsboy
com.embedly
com.emc.cdp
com.enigmastation
com.enragedginger
com.enterprisedt
com.enterprisemath
com.episode6.hackit.chop
com.errplane
com.erudika
com.esotericsoftware
com.esotericsoftware.minlog
com.esotericsoftware.reflectasm
com.esotericsoftware.yamlbeans
com.esri.geoevent.sdk
com.esri.geometry
com.evinceframework
com.eviware.soapui
com.exadel.flamingo.javafx
com.exadel.flamingo.maven.plugin
com.excilys.ebi.gatling
com.excilys.ebi.utils
com.explodingart
com.ezware.oxbow
com.f2prateek
com.f2prateek.progressbutton
com.facebook.mojo
com.facebook.presto.hive
com.facebook.rebound
com.facebook.thirdparty
com.facebook.thirdparty.yourkit-api
com.factati
com.factual
com.fasterxml.staxmate
com.fatboyindustrial.crowd-control
com.fatboyindustrial.gson-javatime-serialisers
com.fatboyindustrial.gson-jodatime-serialisers
com.fedepaolapps.postman
com.feedzai
com.ffbit.maven.plugins
com.fiestacabin.dropwizard.quartz
com.fiestacabin.model
com.fifesoft.rsyntaxtextarea
com.fiftyonred
com.filez.astyanax
com.filez.jta
com.filez.scala
com.firebase.client
com.flagstone
com.flamenk
com.flexiblewebsolutions.xdriveunit
com.flipkart.phantom
com.floreysoft
com.force
com.franklinchen
com.fudeco.hudson
com.fullcontact
com.fusesource.fmc
com.ganshane
com.ganshane.specs
com.garethevans.plugin
com.garrettheel
com.geeoz.ean
com.geeoz.pawl
com.geishatokyo.jetty.tests
com.genzis.filtro
com.gerritdrost.libs.mathie
com.gestalt.jbi.mock
com.gestalt.sip
com.gestalt.sip.utilities
com.getchute.android.sdk.v2
com.getinch.retrogram
com.getperka.cli
com.getperka.client
com.gettyimages
com.ghosthack
com.gingersoftware
com.gistlabs
com.github.aalbul
com.github.abarhub.filerw
com.github.abrarsyed.gmcp
com.github.abrarsyed.jastyle
com.github.adrianboimvaser
com.github.adyliu
com.github.aglover
com.github.ahjohannessen
com.github.aiderpmsi
com.github.alaisi.nalloc
com.github.alaisi.pgasync
com.github.albaker
com.github.alexcojocaru
com.github.alexwibowo
com.github.amigold.fundapter
com.github.amigold.fundapter2
com.github.ampedandwired
com.github.andrewoma.dexx
com.github.ansell.abstract-service-loader
com.github.ansell.hermit
com.github.ansell.property-util
com.github.ansell.restlet-utils
com.github.antlrjavaparser
com.github.apetrelli.samplegwt
com.github.autofixture
com.github.autograder
com.github.avaliani.snapshot
com.github.bassman5
com.github.bcolyn.ajtest
com.github.bednar
com.github.bentorfs
com.github.bicoco
com.github.bmsantos
com.github.briandilley.jsonrpc4j
com.github.brisk
com.github.buzztaiki
com.github.bytecask
com.github.bytelimit
com.github.cage
com.github.cameroncan
com.github.casmi.archetypes
com.github.ceilfors.maven.plugin
com.github.celeskyking
com.github.chenchongli
com.github.chewiebug
com.github.chrisbanes.pulltorefresh
com.github.chrisruffalo
com.github.christopheversieux
com.github.chrisvest
com.github.chytreg
com.github.clemp6r.futuroid
com.github.cletty
com.github.cmis4j
com.github.codingricky
com.github.corner
com.github.crazyfrozenpenguin
com.github.crystalservice
com.github.cschoell
com.github.cverges.expect4j
com.github.cwilper.fcrepo-cloudsync
com.github.cycladessoa
com.github.danielflower.mavenplugins
com.github.dantwining.whitespace-maven-plugin
com.github.dargiri
com.github.davide-maestroni
com.github.davidepastore
com.github.davidmarquis
com.github.dcendents
com.github.destinyd.android.archetypes
com.github.detentor
com.github.devnied
com.github.devnied.AndroidBitmapTransform
com.github.dhaeb
com.github.dita-ot
com.github.dweidenfeld
com.github.dzhaughnroth
com.github.dzsessona
com.github.dzwicker.dart
com.github.emabrey
com.github.excelmapper
com.github.fakemongo
com.github.fdimuccio
com.github.febeling
com.github.fedy2.johloh
com.github.ffgiraldez.migratron
com.github.filipesperandio.vraptor
com.github.fntzr
com.github.francofabio
com.github.fungal
com.github.fworks
com.github.gdfm
com.github.gfx
com.github.gfx.util
com.github.githubpeon
com.github.gkonst
com.github.grat-plugin
com.github.gtxtreme21
com.github.havarunner
com.github.hcguersoy
com.github.himadri77
com.github.hjast
com.github.hoary.javaav
com.github.htfv.utils
com.github.huangp
com.github.iamsteveholmes
com.github.igor-petruk.protobuf
com.github.ikuo
com.github.indykish
com.github.iron9light
com.github.isrsal
com.github.itsmechlark
com.github.ja-fra.zk-configuration
com.github.jaceko.cxf
com.github.jankroken
com.github.janssk1
com.github.japgolly
com.github.japgolly.android
com.github.javacliparser
com.github.javafaker
com.github.jaxb-xew-plugin
com.github.jbellis
com.github.jcandksolutions.gradle
com.github.jdbc-bare
com.github.jdramaix
com.github.jedis-lock
com.github.jeffreyfalgout
com.github.jeluard.ion.plugins
com.github.jeluard.parent-enforcer-rule
com.github.jfno
com.github.jhuir
com.github.jilen
com.github.jjagged
com.github.jkschneider
com.github.jmchilton.blend4j
com.github.jmchilton.galaxybootstrap
com.github.joelittlejohn.embedmongo
com.github.johnpersano
com.github.jonathanhds
com.github.jpbetz
com.github.jreddit
com.github.jryans.jless
com.github.jsimone
com.github.jsonj
com.github.jsqlparser
com.github.jt-org
com.github.jtakakura
com.github.jtxer
com.github.jucovschi
com.github.judoole
com.github.junrar
com.github.jzila
com.github.K0zka
com.github.kedzie.draggabledrawers
com.github.kedzie.supportanimator
com.github.kingamajick.admp
com.github.klangfarbe
com.github.klasu
com.github.klieber
com.github.kohanyirobert
com.github.kompot
com.github.kongchen
com.github.krasa
com.github.krispo
com.github.kristianhelgesen.aramis
com.github.krosenvold
com.github.krukow
com.github.kulya
com.github.kw3r
com.github.kyleburton
com.github.ladutsko
com.github.ldriscoll
com.github.lecogiteur
com.github.lehphyro.branch-maven-plugin
com.github.lehphyro.fastbuilder
com.github.lehphyro.money
com.github.leleuj.play
com.github.leleuj.springframework.security
com.github.levants
com.github.lhanson
com.github.lightdocs
com.github.lite2073
com.github.lonnyj
com.github.lpandzic
com.github.lpandzic.chameleon
com.github.lsiu.maven.plugins
com.github.manuelpeinado.fadingactionbar
com.github.manuelpeinado.fadingactionbar-native
com.github.manuelpeinado.imagelayout
com.github.manuelpeinado.multichoiceadapter
com.github.manuelpeinado.numericpageindicator
com.github.manuelpeinado.refreshactionitem
com.github.manuelpeinado.refreshactionitem-native
com.github.marceloverdijk
com.github.markserrano
com.github.martin-g
com.github.maven-hadoop.plugin
com.github.maven-integration-test-helper
com.github.mavenplugins
com.github.maxbraun
com.github.maxxkrakoa.lineman-maven-plugin
com.github.mayconbordin
com.github.mbenson
com.github.mcheely
com.github.metadave
com.github.mgeiss
com.github.mhshams
com.github.michaeldoyle
com.github.michaelpisula
com.github.michelzanini
com.github.migralito
com.github.mike10004
com.github.mikesena.maven.shared
com.github.misberner.ap-commons
com.github.misberner.buildergen
com.github.mistertea
com.github.mkolisnyk
com.github.mlaccetti
com.github.mmazi
com.github.mohitsoni
com.github.monjo
com.github.mpilquist
com.github.mrcritical
com.github.mschaeuble
com.github.mxab.thymeleaf.extras
com.github.Navisayslisten
com.github.nayuki
com.github.nhuray
com.github.nicholasren
com.github.nickvl
com.github.nlloyd
com.github.nociar
com.github.nrudenko
com.github.oboehm
com.github.oehme.jnario
com.github.okapies
com.github.olim7t
com.github.ombre42
com.github.oohira
com.github.org-arl
com.github.os72
com.github.oxo42
com.github.pabzdzdzwiagief
com.github.pabzdzdzwiagief.initialization
com.github.pageobject
com.github.patching
com.github.paulmoloney
com.github.peichhorn
com.github.pellaton.estol
com.github.pfichtner
com.github.pfmiles
com.github.pguedes
com.github.pjagielski.spring-boot-swagger
com.github.plecong
com.github.plombard
com.github.pmerienne
com.github.pnayak
com.github.pnowy.nc
com.github.pojomvcc
com.github.praxissoftware
com.github.praxissoftware.maven.plugins
com.github.praxissoftware.rest
com.github.praxissoftware.testing
com.github.qihootest
com.github.raychatter
com.github.raycw
com.github.redattack34
com.github.reinert
com.github.relaxng
com.github.remis-thoughts
com.github.rgladwell
com.github.rholder.fauxflake
com.github.richardwill98.elasticsearch
com.github.richardwilly98.elasticsearch
com.github.righettod
com.github.rishihahs.wordsearchsolver
com.github.rlespinasse
com.github.robfletcher
com.github.robocup-atan
com.github.rockh
com.github.rodionmoiseev.gradle.plugins
com.github.romix
com.github.romix.akka
com.github.rotty3000
com.github.roughy.http.util
com.github.rsimoni
com.github.rssh
com.github.runeflobakk
com.github.ryenus
com.github.s4u
com.github.sabomichal
com.github.sakebook
com.github.samueltbrown
com.github.sandre.contrail
com.github.sblundy.gradle.dependencymanagement
com.github.sbtourist
com.github.sclassen
com.github.sdb
com.github.sebhoss.common
com.github.segmentio
com.github.serddmitry
com.github.sevntu-checkstyle
com.github.sfleiter.cdi-interceptors
com.github.shyiko.hadoop-maven-plugin
com.github.shyiko.servers-maven-extension
com.github.shyiko.usage-maven-plugin
com.github.signed.junit
com.github.signed.jvm-protocol-handler
com.github.signed.pockuito
com.github.sinemetu1
com.github.skazzyy.gradle.plugins
com.github.skwakman.nodejs-maven-plugin
com.github.slezier
com.github.snakerflow
com.github.snowdream.android.database
com.github.snowdream.android.util.concurrent
com.github.snowdream.android.widget
com.github.snowindy
com.github.socketIo4Netty
com.github.sogyf
com.github.sola92
com.github.springtestdbunit
com.github.sps.mustache
com.github.sps.pushover.net
com.github.srec
com.github.sriki77
com.github.staslev
com.github.stephenc.definalizer
com.github.stephenc.eaio-grabbag
com.github.stephenc.hector
com.github.stephenc.jcip
com.github.stephenc.mongodb
com.github.stephenc.nonmavenjar
com.github.stephenc.simple-java-mail
com.github.stephenc.wagon
com.github.susom
com.github.svenmeier.wicket-box
com.github.svenmeier.wicket-dnd
com.github.sworisbreathing.ehcachefilemonitor
com.github.synesso
com.github.tbekolay.jnumeric
com.github.tbodt
com.github.technomancy
com.github.terentich
com.github.terma
com.github.tfoxcroft
com.github.theborakompanioni
com.github.thehilikus.events
com.github.timols
com.github.timoteoponce
com.github.tkurz.webjars
com.github.tmingos
com.github.tomyeh
com.github.tonybaines
com.github.townsfolk
com.github.triplet.simpleprovider
com.github.trixt0r
com.github.tstout
com.github.tulskiy
com.github.tuxychandru
com.github.umeshawasthi
com.github.uncommon-configuration
com.github.unguiculus.maven
com.github.unlog
com.github.valdr
com.github.velvia
com.github.villadora
com.github.wavesoftware
com.github.wayis.framework
com.github.wayis.framework.test
com.github.webdriverextensions
com.github.westonpace.jayvee
com.github.wicket-acc
com.github.winsonlim
com.github.wokier.progress-maven-plugin
com.github.wuic.plugins
com.github.wvengen
com.github.xaguzman
com.github.xian
com.github.yihtserns
com.github.zafarkhaja
com.github.zhve
com.github.ziplet
com.github.zutherb.gradle
com.gjcourt
com.gocardless
com.goinstant
com.goldin
com.goldin.plugins
com.gooddata
com.google
com.google.android.apps.dashclock
com.google.android.apps.muzei
com.google.api
com.google.appengine.demos
com.google.appengine.orm
com.google.auto
com.google.auto.factory
com.google.auto.service
com.google.auto.value
com.google.closure-stylesheets
com.google.code.axon-guice
com.google.code.bean-matchers
com.google.code.byteseek
com.google.code.externalsortinginjava
com.google.code.gaeom
com.google.code.geocoder-java
com.google.code.google-proto-simple-reader-writer
com.google.code.guice-repository
com.google.code.guice-vaadin-mvp
com.google.code.gwt-math
com.google.code.jain-sip-rfc3263-router
com.google.code.jbpm-guice
com.google.code.jgntp
com.google.code.jhtmldiff
com.google.code.jkippt
com.google.code.jlibav
com.google.code.jsd-maven
com.google.code.mathparser-java
com.google.code.maven-license-plugin
com.google.code.maven-play-plugin.com.jamonapi
com.google.code.maven-play-plugin.hsqldb
com.google.code.maven-play-plugin.net.tanesha.recaptcha4j
com.google.code.maven-play-plugin.org.apache.commons
com.google.code.maven-play-plugin.org.hibernate
com.google.code.maven-play-plugin.org.playframework.modules.accesslog
com.google.code.maven-play-plugin.org.playframework.modules.associations
com.google.code.maven-play-plugin.org.playframework.modules.betterlogs
com.google.code.maven-play-plugin.org.playframework.modules.cobertura
com.google.code.maven-play-plugin.org.playframework.modules.coffee
com.google.code.maven-play-plugin.org.playframework.modules.constretto
com.google.code.maven-play-plugin.org.playframework.modules.db
com.google.code.maven-play-plugin.org.playframework.modules.ebean
com.google.code.maven-play-plugin.org.playframework.modules.excel
com.google.code.maven-play-plugin.org.playframework.modules.fastergt
com.google.code.maven-play-plugin.org.playframework.modules.fbgraph
com.google.code.maven-play-plugin.org.playframework.modules.gae
com.google.code.maven-play-plugin.org.playframework.modules.grizzly
com.google.code.maven-play-plugin.org.playframework.modules.guice
com.google.code.maven-play-plugin.org.playframework.modules.hazelcast
com.google.code.maven-play-plugin.org.playframework.modules.less
com.google.code.maven-play-plugin.org.playframework.modules.mockito
com.google.code.maven-play-plugin.org.playframework.modules.morphia
com.google.code.maven-play-plugin.org.playframework.modules.paginate
com.google.code.maven-play-plugin.org.playframework.modules.pdf
com.google.code.maven-play-plugin.org.playframework.modules.postmark
com.google.code.maven-play-plugin.org.playframework.modules.qunit
com.google.code.maven-play-plugin.org.playframework.modules.redis
com.google.code.maven-play-plugin.org.playframework.modules.router
com.google.code.maven-play-plugin.org.playframework.modules.sass
com.google.code.maven-play-plugin.org.playframework.modules.search
com.google.code.maven-play-plugin.org.playframework.modules.siena
com.google.code.maven-play-plugin.org.playframework.modules.springtester
com.google.code.maven-play-plugin.org.playframework.modules.testrunner
com.google.code.maven-play-plugin.org.playframework.modules.webdrive
com.google.code.maven-play-plugin.postgresql
com.google.code.maven-svn-wagon
com.google.code.mjl
com.google.code.p
com.google.code.reflection-utils
com.google.code.simplelrucache
com.google.code.spring-crypto-utils
com.google.code.sqlsheet
com.google.code.struts2jscalendarplugin
com.google.code.tld-generator
com.google.code.tycho-eclipserun-plugin
com.google.code.typica
com.google.code.xbean
com.google.diffable
com.google.doclava
com.google.guiceberry
com.google.gwt.eventbinder
com.google.gxp
com.google.java.contract
com.google.maps
com.google.okhttp
com.google.sgnodemapper
com.google.template
com.google.testing.compile
com.google.visualization
com.googlecode.addjars-maven-plugin
com.googlecode.aic-praise
com.googlecode.aima-java
com.googlecode.alfresco-repository-extensions
com.googlecode.android-player-root-archetype
com.googlecode.android-query
com.googlecode.appassembler-maven-plugin
com.googlecode.armbrust-file-utils
com.googlecode.backport-spi
com.googlecode.batchfb
com.googlecode.blacken
com.googlecode.cirrostratus
com.googlecode.classgenerator
com.googlecode.classgrep
com.googlecode.clj4j
com.googlecode.combinatoricslib
com.googlecode.concurrent-locks
com.googlecode.concurrent-trees
com.googlecode.crowdin-maven
com.googlecode.data-object-generator
com.googlecode.dummyjdbc
com.googlecode.easymockrule
com.googlecode.entreri
com.googlecode.events-on-fire
com.googlecode.excavator
com.googlecode.ez-vcard
com.googlecode.fannj
com.googlecode.fighting-layout-bugs
com.googlecode.flexistate
com.googlecode.flickrj-android
com.googlecode.fluido-skin
com.googlecode.fmpp-dataloaders
com.googlecode.foresite-toolkit
com.googlecode.funcito
com.googlecode.gant-ext
com.googlecode.gazpacho-examples
com.googlecode.gbench
com.googlecode.gendevcode
com.googlecode.genproject
com.googlecode.gflot
com.googlecode.gmail4j
com.googlecode.googleplus
com.googlecode.grep4j
com.googlecode.guice-autoreg
com.googlecode.gwt-action
com.googlecode.gwt-charts
com.googlecode.gwt-cropper
com.googlecode.gwt-proxy-servlet
com.googlecode.gwt-table-to-excel
com.googlecode.gwt-validation
com.googlecode.gwtcodemirror
com.googlecode.gwtphonegap
com.googlecode.gwtutils
com.googlecode.hiberpcml
com.googlecode.horkizein
com.googlecode.httpliar
com.googlecode.ibaguice
com.googlecode.janrain4j
com.googlecode.japis
com.googlecode.jarjar
com.googlecode.jasima
com.googlecode.java-bit-arrays
com.googlecode.java-cl-parser
com.googlecode.java-ipv6
com.googlecode.javaeeutils
com.googlecode.jaxb-namespaceprefixmapper-interfaces
com.googlecode.jchord
com.googlecode.jcsv
com.googlecode.jdatatables
com.googlecode.jdbc-proc
com.googlecode.jdbw
com.googlecode.jen-api
com.googlecode.jfreesane
com.googlecode.jgenhtml
com.googlecode.jhocr
com.googlecode.jmapper-framework
com.googlecode.jsmpp
com.googlecode.jsontoken
com.googlecode.jstd-maven-plugin
com.googlecode.juffrou
com.googlecode.junice
com.googlecode.junit-toolbox
com.googlecode.jweb1t
com.googlecode.jxquery
com.googlecode.kevinarpe-papaya-swing
com.googlecode.komarro
com.googlecode.l10n-maven-plugin
com.googlecode.lanterna
com.googlecode.lightity
com.googlecode.luceneappengine
com.googlecode.mapperdao
com.googlecode.mapping4java
com.googlecode.marrowboy
com.googlecode.mate-tools
com.googlecode.maven-gcu-plugin
com.googlecode.maven-java-formatter-plugin
com.googlecode.maven-javacodegen-plugin
com.googlecode.maven-license-validator-plugin
com.googlecode.maven-migration-plugin
com.googlecode.maven-overview-plugin
com.googlecode.maven-properties-enum-plugin
com.googlecode.mavenfilesync
com.googlecode.mavennatives
com.googlecode.mdock
com.googlecode.memcachefy
com.googlecode.mgwt
com.googlecode.miyamoto
com.googlecode.mobilityrpc
com.googlecode.mojo-sprites
com.googlecode.mp4parser
com.googlecode.mvp4g
com.googlecode.ndbc-buoy4j
com.googlecode.objectify-appengine-spring
com.googlecode.objectify-query
com.googlecode.openid-discovery-maven-plugin
com.googlecode.openpojo
com.googlecode.owasp-java-html-sanitizer
com.googlecode.perfect-hashes
com.googlecode.places-api-client
com.googlecode.princeton-java-algorithms
com.googlecode.refit.test
com.googlecode.robotframework-maven-plugin
com.googlecode.s2rome
com.googlecode.sarasvati.thirdparty.eclipse
com.googlecode.sbinary
com.googlecode.scala-midi
com.googlecode.scalaconcurrency
com.googlecode.scalascriptengine
com.googlecode.selenium-uitaf
com.googlecode.server-test-toolkit
com.googlecode.servletfilters
com.googlecode.simpleobjectassembler
com.googlecode.siren4j
com.googlecode.sizeofag
com.googlecode.slotted
com.googlecode.smartgwt-maven-plugin
com.googlecode.smartmodules-maven-extension
com.googlecode.sparsebitmap
com.googlecode.spring-appengine
com.googlecode.spring-contributions
com.googlecode.spring-event-router
com.googlecode.streamflyer-regex-fast
com.googlecode.struts2yuiplugin
com.googlecode.surfaceplotter
com.googlecode.swing-assignmentdialog
com.googlecode.testcase-annotation
com.googlecode.texhyphj
com.googlecode.the-fascinator.maven-plugins
com.googlecode.thread-weaver
com.googlecode.tinydi
com.googlecode.todomap
com.googlecode.valogato
com.googlecode.velocity-maven-plugin
com.googlecode.vfsjfilechooser2
com.googlecode.vmock
com.googlecode.webutilities
com.googlecode.wicket-charts
com.googlecode.xmlblackbox
com.googlecode.xmlzen
com.googlecode.xremoting
com.googlecode.zohhak
com.grack
com.grahamedgecombe.jterminal
com.greenlaw110.rythm
com.greenmoonsoftware
com.gregmarut.support
com.griddynamics.genesis
com.groupon
com.groupon.mapreduce
com.groupon.messagebus
com.groupon.novie
com.groupon.roboremote.roboremoteclient
com.hacklanta
com.haiwanwan
com.haiwanwan.common
com.hamburgsud.aludratest
com.handpoint
com.hazeltask
com.hbakkum.rundeck.plugins
com.hbakkum.template
com.healthmarketscience.rmiio
com.healthmarketscience.sqlbuilder
com.helpshift
com.hermit-reasoner
com.hexaid.struts2.junit
com.heywatch
com.highwise
com.hp.gagawa
com.huaban
com.hubspot.dropwizard
com.hubspot.liveconfig
com.huskycode
com.ibm.db2.jcc
com.ibm.spss.hive.serde2.xml
com.identityblitz
com.iinteractive
com.ikokoon.serenity.hudson
com.imaginary
com.imminentmeals
com.impetus
com.impetus.core
com.impetus.kundera
com.impetus.kundera.rest
com.importio
com.indeed.logstash.log4j
com.indextank
com.indicative.client.java
com.ingemark
com.ingres.jdbc
com.innahema
com.innoq.qmqp
com.inocybe.api
com.insanitydesign
com.insidecoding
com.insightfullogic.release
com.instructure
com.intellectfactory.maven.plugins
com.intellifylearning
com.intentmedia
com.internetitem
com.intersystems
com.io7m.jrpack
com.io7m.jspatial.examples-jogl
com.io7m.jspatial.examples-swing
com.io7m.jvvfs
com.io7m.jvvfs.core
com.io7m.jvvfs.shell
com.io7m.saxon-plugin
com.io7m.xom
com.ircclouds.irc
com.isenshi
com.isomorphic
com.itextpdf.maven
com.iteye.yangdong
com.ivonacloud
com.j256.simplejmx
com.j256.simplemagic
com.j2speed
com.jaeksoft
com.jakewharton.fliptables
com.jakewharton.madge
com.jakewharton.scalpel
com.jakewharton.sdkmanager
com.jamcracker.adapter.jit
com.jamcracker.jifs
com.jamesward
com.jamierf.dropwizard
com.janramm
com.jatinpuri
com.java-adventures.glassfish.realm.salted
com.java-adventures.junit
com.javadocmd
com.javadude
com.javaslang
com.javax0.scriapt
com.jayway.facebooktestjavaapi.examples
com.jayway.maven.plugins.lab
com.jayway.restfuljersey
com.jeffknecht.dynadao
com.jelastic
com.jintegrity
com.jnape.dynamic-collections
com.joanzapata.mapper
com.joanzapata.utils
com.joepritzel
com.johnsoncs.gwt
com.jolira.logdb
com.jolira.types.checkers
com.jonnywray.vertx
com.jontodd
com.jopss
com.josephpconley
com.joshcanfield
com.joyent.manta
com.jsmartframework
com.jtechdev
com.jujunie.service
com.julienvey.trello
com.juvenxu.portable-config-maven-plugin
com.jzeromq
com.kapilvirenahuja
com.kasisoft
com.kdgregory.bcelx
com.keminglabs
com.kenai.jbosh
com.kenai.jxse
com.keyboardsamurais.maven
com.keypoint
com.keysolutions
com.kifi
com.kirkk
com.kitfox
com.kiuwan
com.klarna
com.klout
com.knappsack
com.knewton.mapreduce
com.koushikdutta.async
com.koushikdutta.ion
com.koushikdutta.urlimageviewhelper
com.kpelykh
com.kupal
com.kupal.ahk4j
com.kurento.kms
com.kwebble
com.kwince.contribs
com.laamella.properteer
com.label305.kama-for-android
com.label305.stan
com.lambdazen.bitsy
com.lambdazen.htmlsplicer
com.lambdazen.websocket
com.lasmanis
com.lassitercg
com.lateral-thoughts
com.lateral-thoughts.stub
com.lazerycode.selenium
com.lazythought
com.leacox.process
com.letsdoapps.depsio.maven
com.levigo
com.lexicalscope.contest
com.lexicalscope.fluent-collections
com.lexicalscope.fluent-reflection
com.lexicalscope.junit
com.lhkbob.entreri
com.librato
com.librato.disco
com.librato.rollout
com.liferay.faces.patches
com.liferay.maven.plugins
com.liferay.mobile
com.likeness
com.likeness.mojo
com.likethecolor
com.linagora
com.linkedin.azkaban
com.linkedin.parseq
com.lipaluma
com.lithium
com.lithium.multiverse-test
com.livefyre
com.loadimpact
com.locadz
com.locurasoft
com.logentries
com.logiclander.jaasmine
com.logitags
com.loopj.android
com.lordofthejars.thymeleafarchetype
com.loudsight
com.lucidchart
com.luckycatlabs
com.luhuiguo
com.luigiagosti
com.lukegb.mojo
com.lunatech.jax-doclets
com.luxoft.mybatis
com.luzi82.hakase
com.lyft
com.lyncode.builder
com.lyncode.xml
com.m3958
com.m3958.vertxio
com.m3958.vertxprj
com.macasaet.lambda
com.madisp.pretty
com.madisp.stupid
com.madrobot
com.mailosaur
com.malagasys
com.mandrillapp.wrapper.lutung
com.mangofactory.swagger
com.manymo
com.mapbox.mapboxsdk
com.mapzen
com.marcgrue
com.markatta
com.martincuervo
com.martinkl.warc
com.mashape.unirest
com.massfords
com.matthewjosephtaylor.archetypes
com.mattprecious.telescope
com.matttproud.accepts
com.matttproud.quantile
com.maxmind.geoip
com.maxmind.geoip2
com.maxmind.maxminddb
com.maxmind.ws
com.mchai.utils
com.mckoi
com.mcxiaoke.commons
com.mcxiaoke.oauthsimple
com.mcxiaoke.volley
com.mebigfatguy
com.mebigfatguy.blocklist
com.mebigfatguy.deadmethods
com.mebigfatguy.fb-contrib
com.mebigfatguy.gnomeminesplaya
com.mebigfatguy.vcsversion
com.mebigfatguy.yank
com.megatome.knowndefects
com.melessoftware.hamcrest
com.melessoftware.testing
com.melloware
com.meltmedia.jgroups
com.messagegears
com.messners
com.meterware.simplestub
com.meterware.xml
com.metrink.croquet
com.mgmtp.maven.resources
com.michaelbaranov
com.michaelpollmeier
com.microsoft.office
com.microsoft.wake
com.microsoft.windowsazure.storage
com.microsoftopentechnologies
com.mikecouturier
com.mikenimer
com.mikewinkelmann
com.mindscapehq.android
com.mindsnacks.javazinc
com.mistraltech.smog
com.mixpanel
com.mmakowski
com.moandjiezana.jamon
com.moandjiezana.toml
com.mobilvox.ossi.mojo
com.mobprofs
com.mohaine
com.mojolly.http
com.monochromeroad.gradle-plugins
com.moparisthebest.beehive
com.mortardata.api
com.mottimotti.android
com.mpatric
com.mtvi.plateng.maven
com.mtvi.plateng.subversion
com.muhuk.lesscss
com.mycila.maven
com.mycila.maven-license-plugin
com.mycodefu
com.myjeeva.digitalocean
com.myjeeva.poi
com.mysema.codegen
com.mysema.contracts
com.mysema.converters
com.mysema.l10n
com.mysema.luja
com.mysema.rdfbean
com.mysema.stat
com.mysema.web
com.mysimpatico
com.mysql.jdbc
com.n3twork
com.nabilhachicha
com.namomedia.android
com.nappingcoder
com.navercorp.pulltorefresh
com.navnorth.learningregistry
com.nebhale.jsonpath
com.nebula.gradle
com.needhamsoftware
com.neenbedankt.gradle.plugins
com.nerderg.ajaxanywhere
com.nervepoint
com.nesscomputing.instagram
com.nesscomputing.service.activemq
com.netaporter.salad
com.netbout.helpers
com.netflix.amazoncomponents
com.netflix.blitz4j
com.netflix.evcache
com.netflix.frigga
com.netflix.glisten
com.netflix.lipstick
com.netflix.nfgraph
com.netflix.numerus
com.netflix.pigpen
com.netflix.priam-cass-extensions
com.netflix.pytheas
com.netflix.turbine
com.netflix.zeno
com.netmera.mobile
com.neuronrobotics
com.nevermindsoft
com.newmainsoftech.eatestutil.containerconfig
com.newmainsoftech.spray
com.nexirius
com.nflabs
com.nhaarman.ergo
com.nhaarman.listviewanimations
com.nicholaspaulsmith
com.nilcaream.utilargs
com.ning.jdbi
com.ning.killbill
com.ninja-squad
com.nirima.jdocker
com.nirima.jlibvirt
com.nitayjoffe.thirdparty.com.jointhegrid
com.nitayjoffe.thirdparty.com.snowplowanalytics
com.nitayjoffe.thirdparty.net.robowiki.knn
com.nitayjoffe.thirdparty.org.ggp
com.nitayjoffe.thirdparty.org.j3d
com.nitayjoffe.util
com.noahsloan.atg
com.noctarius.bz2java
com.noctarius.castmapr
com.noodlesandwich
com.norbitltd
com.nothome
com.notnoop.apns
com.nouveauxterritoires.maven
com.novaquark
com.noveogroup
com.nrmitchi.plugin
com.nullprogram
com.nuodb.hibernate
com.nuodb.jdbc
com.nurkiewicz.asyncretry
com.ocpsoft.forge
com.octo.java-sql-dsl
com.offbytwo
com.offbytwo.iclojure
com.offbytwo.jenkins
com.ohadr.oauth2
com.omg-m.speedy.eps
com.omrispector
com.onsmsc
com.opengamma
com.openshift
com.openshift.express
com.opensudoku.bible
com.opensudoku.go
com.opensudoku.puzzle
com.opensudoku.sudoku
com.opensymphony.oscache
com.opensymphony.propertyset.providers
com.opensymphony.quartz
com.opensymphony.xwork
com.opentok.api
com.opnworks.maven
com.opower
com.opower.hadoop.elephant-plug
com.optersoft
com.oracle.cdi-enabler
com.oracle.coherence.spring
com.orange.wro4j
com.orangesignal
com.orangevolt
com.orctom.mojo
com.originate
com.osinka.slugify
com.othelle.jtuples
com.outr.javasysmon
com.overstock.findbugs
com.owtelse.util
com.palletops
com.palominolabs.config
com.palominolabs.gradle.task
com.palominolabs.heroku
com.palominolabs.xpath
com.panemu
com.parship
com.path
com.paymill
com.paymill.android
com.payneteasy
com.pcl-solutions.maven.reports
com.pcl-solutions.maven.wagons
com.peircean.glusterfs
com.persado.oss.quality.stevia
com.peterphi.aws.snapshotd
com.peterphi.std
com.peterphi.std.index
com.peterphi.std.util.carbon
com.phasebash.jackson
com.phloc.maven
com.phonedeck
com.pieceof8.gradle
com.pingunaut
com.pipl.api
com.pixelpark.seraph
com.plausiblelabs.metrics
com.plivo
com.podio
com.polymathiccoder
com.polysfactory.headgesturedetector
com.polysfactory.lib.glass.bluetooth
com.polysfactory.lib.guitarparty
com.portlandwebworks
com.portletguru
com.prezi.haxe
com.prezi.typescript
com.progress.hudson
com.projectdarkstar.ext.net.java.dev.gluegen
com.projectdarkstar.ext.net.java.dev.jogl
com.projectdarkstar.maven.plugin
com.projectmadcow
com.projetloki
com.proofpoint.cloudmanagement.service
com.proofpoint.discovery-announcer
com.proofpoint.hive
com.prowidesoftware
com.psclistens.gru
com.pseudocode
com.puresoltechnologies.i18n4java
com.puresoltechnologies.kickstart
com.puresoltechnologies.maven.plugins
com.pusher
com.pyruby
com.qcfsoftware
com.qiniu
com.qitsoft
com.qlusters.jlmenu
com.qmetry
com.qozix
com.qspin.qtaste.plugin
com.quantasnet.management
com.quartzdesk
com.rackspace.apache
com.rackspace.api.clients
com.rackspace.eclipse.webtools.sourceediting
com.rallydev
com.rallydev.rest
com.randomnoun.bandcamp
com.randomnoun.common
com.randomnoun.maven.doxia
com.randomnoun.maven.plugins
com.randomnoun.songkick
com.raonirenosto
com.rapid7.conqueso
com.rapid7.pax
com.rapid7.trools
com.ravellosystems.plugins
com.readystatesoftware.ghostlog
com.readystatesoftware.sqliteasset
com.readystatesoftware.systembartint
com.readytalk
com.recursivity
com.redfin.hudson
com.redhat.qe
com.redhat.rcm.maven.plugin
com.redspr.redrobot
com.redv.bloggerapi
com.reflectk.inspect4j
com.relayrides
com.relops
com.rempl.profiles
com.rempl.reporters
com.resare.id3j
com.resare.jresolver
com.restfuse
com.retailmenot
com.reubenpeeris
com.reubenpeeris.maven
com.reuters
com.rimerosolutions.maven.plugins
com.riskfocusinc
com.rjohnst.hudson.plugins.concordionpresenter
com.robestone.hudson
com.rockymadden.jbrainhoney
com.rodiontsev.maven.plugins
com.roguedevs
com.rosaloves
com.rossabaker
com.roundtriangles.games
com.rrs-apps.java.jirclib
com.ruleoftech
com.ryantenney.log4j
com.ryantenney.metrics
com.ryantenney.passkit4j
com.sailthru.client
com.samaxes.cachefilter
com.samaxes.filter
com.samaxes.securetag
com.samaxes.stripejb3
com.samaxes.stripes.ejb3
com.samaxes.taglib
com.samebug.notifier
com.sap.prd.mobile.ios.maven.plugins
com.sap.prd.mobile.ios.ota
com.saplo
com.sappenin.ms.activitystrea
com.sappenin.objectify
com.saulpower.communication
com.saulpower.fayeclient
com.savage7.maven.plugins
com.savoirtech.aetos
com.savvasdalkitsis
com.scalableminds
com.scalapenos
com.scriptbasic
com.scurrilous
com.sdl.lt
com.seaglasslookandfeel.siteskin
com.seanchenxi.gwt
com.sematext.hbasehut
com.sematext.hbasewd
com.semperos
com.sendgrid
com.sendgrid.labs
com.senseidb.clue
com.sergiandreplace
com.servlets
com.servprise.maven.plugins
com.servprise.webreboot
com.shankyank.mojo
com.sharethis
com.sharethrough
com.shedhack
com.shopizer
com.shrevl
com.siemens.ct.exi
com.siemens.oss.omniproperties
com.signalcollect
com.sigpwned
com.siirush
com.silvermindsoftware.stripes
com.simplegeo
com.simplermi
com.simplify
com.simpligility.org.apache.maven.shared
com.simpligility.sonatype.book
com.sirtrack
com.sittinglittleduck
com.sixdimensions.commons.osgi.wrapper
com.skplanet
com.sksamuel
com.sksamuel.diff
com.sksamuel.gwt
com.sksamuel.jmxc
com.sksamuel.kafka
com.sksamuel.nsq
com.sksamuel.scalocity
com.sksamuel.scam
com.sksamuel.scoot
com.skysql.java
com.smarchive.dropwizard
com.smartitengineering.smart-util
com.smartling
com.smartling.maven
com.smartsheet
com.smb-tec.neo4j
com.smb-tec.xo
com.smb-tec.xo.archetypes
com.smith9.geiger
com.sna-projects.cleo
com.sna-projects.kamikaze
com.snda
com.snell.michael.cutlet
com.socialbakers
com.soebes.maven.plugins.dmg
com.soebes.maven.plugins.mlv
com.soebes.subversion.sapm
com.softlayer
com.software-ninja
com.sohu
com.sohu.cache
com.sohu.jafka
com.solab.scalasql
com.sonatype.clm
com.sonatype.insight
com.sonymobile.tools.gerrit
com.sop4j
com.sorcix
com.soulgalore.web
com.soundcloud
com.sourceallies.beanoh
com.sourceclear
com.sourcecoding
com.sourcemuse.gradle.plugin
com.sourceninja
com.sourcesense.maven
com.sourcetohtml
com.sparetimecoders
com.specialprojectslab
com.speedment
com.spothero.volley
com.spotify.sparkey
com.spreadthesource
com.springrts
com.springrts.springls
com.sqality
com.squants
com.squareup.gradle
com.squareup.mimecraft
com.squareup.okio
com.squareup.phrase
com.squidpony
com.ssg.tools
com.stackdriver
com.stanfy
com.stanfy.android
com.stanfy.mattock
com.stanfy.spoon
com.stephenduncanjr
com.stevewedig
com.stormpath.shiro
com.stormpath.spring.security
com.stoyanr.mastermind
com.stronglinks
com.stuartsierra
com.stumbleupon
com.stvconsultants
com.sudhir.utils
com.sugarcrm
com.sumologic.api.client
com.sun.enterprise.glassfish
com.sun.faces.portlet
com.sun.faces.regression
com.sun.faces.test
com.sun.fastinfoset.runtime
com.sun.georss-rome
com.sun.japex.jdsl
com.sun.jersey.experimental
com.sun.jersey.experimental.view-client.jersey-view-client-samples
com.sun.jersey.samples.moxy-oxm-mapping
com.sun.jersey.test
com.sun.jersey.test.osgi
com.sun.maven
com.sun.org.apache
com.sun.phobos.samples
com.sun.pkg.client
com.sun.script.freemarker
com.sun.tools.jxc.maven2
com.sun.tools.xjc.maven2
com.sun.voip
com.sun.wts.tools.ant
com.sun.wts.tools.maven
com.sun.wts.tools.mri
com.sun.xml.bind.external
com.sun.xml.bind.mvn
com.sun.xml.registry
com.sun.xml.ws.security.kerb
com.sun.xml.wss.core.reference
com.surelogic
com.svashishtha
com.svenjacobs.gwtbootstrap3
com.svenjacobs.lugaene
com.swiftelan
com.sybase.jdbc3.jdbc
com.synopsys.arc.jenkinsci
com.sysbliss.utils
com.systemsplanet.plugin
com.tactix4
com.taobao
com.taobao.test
com.tdunning
com.teamcodeflux.android
com.teamunify
com.techmale
com.tecnoguru.scuby
com.telapi.api
com.temis
com.tenderowls.opensource
com.tensorwrench.gradle
com.tensorwrench.mongodb
com.tensorwrench.shiro
com.terracottatech
com.terremark
com.testingbot
com.texry
com.textrazor
com.thehayro
com.theisenp.vicarious
com.theotherian.dns
com.thetus.maven
com.thewonggei
com.thilko.spring
com.thinkaurelius.faunus
com.thinkaurelius.thrift
com.thoughtworks
com.thoughtworks.mockpico
com.thoughtworks.selenium
com.thousandmemories.photon
com.threewks.analytics
com.tictactec
com.tiemens
com.tikal
com.timshadel
com.tiobe.jacobe
com.tkruse.gradle
com.tngtech.confluence.plugins
com.tobedevoured
com.tobedevoured.command
com.tobedevoured.naether
com.tocea.scertify.maven
com.toddfast.preconditions
com.toddfast.typeconverter
com.tokbox
com.tombrus.hudson.dostrigger
com.tomcawley
com.toolazydogs.aunit
com.toolazydogs.shiro
com.tophermiller
com.tqlab.plugin
com.treode
com.tri-systems.persistence
com.triptheone
com.trsvax
com.trustev
com.tumblr
com.tunyk.currencyconverter
com.tunyk.jsonbatchtranslate
com.tunyk.mvn.plugins.htmlcompressor
com.tupilabs.image_gallery
com.twelvemonkeys.servlet
com.twilio
com.twilio.sdk
com.twotoasters.jazzylistview
com.typesafe.zinc
com.u1aryz
com.ubervu
com.ubidots
com.uiobjects
com.umatrangolo
com.unboundid.components
com.unbxd
com.uncopt
com.unicodecollective
com.unister.semweb
com.untzuntz.authy
com.uphyca.idobata
com.uphyca.robota
com.uphyca.testing
com.uploadcare
com.urbanmania
com.uservoice
com.uwetrottmann.seriesguide
com.v-collaborate
com.vaadin.external.flute
com.vaadin.external.google
com.vaadin.external.slf4j
com.vaadin.external.streamhtmlparser
com.valchkou.datastax
com.vandalsoftware
com.vandalsoftware.tools.gradle
com.vast.common
com.vecna.checkstyle
com.venturocket
com.verhas
com.versioneye
com.veskogeorgiev
com.viadeo.axonframework
com.viewpagerindicator
com.vikingbrain
com.vineetmanohar
com.vladmihalcea
com.vngrs.jsondroid
com.voltvoodoo
com.voodoodyne.jackson.jsog
com.voodoodyne.tagonist
com.voodoodyne.trivet
com.voodoodyne.unsuck
com.vseravno.solna
com.vtence.cli
com.vtence.molecule
com.vtence.tape
com.wadpam.oauth
com.wadpam.survey
com.walding
com.walletkit
com.wandisco
com.wandoulabs.akka
com.watchitlater
com.weather
com.webguys
com.webrippers
com.weiglewilczek.bnd4sbt
com.wenzani
com.whalin
com.whyun
com.willowtreeapps.android.maven.plugins
com.willowtreeapps.gradle.plugins
com.willowtreeapps.maven.plugins
com.wizecommerce
com.wizzardo.tools
com.wmbest.gradle
com.womply.cassandradao
com.workingmouse
com.workplacesystems.queuj
com.wwpass
com.x5dev
com.xebia.incubator
com.xebialabs.restito
com.xiantrimble.combinatorics
com.xiaoleilu
com.xiaomi.infra
com.ximpleware
com.xiplink.jira.git
com.xlson.groovycsv
com.xmlcalabash
com.xored.maven
com.xpfriend
com.xsolla
com.yamanyar
com.yammer.collections
com.yammer.dropwizard.testing
com.yandex.android
com.yasudanetwork.struts2
com.yasuoza.plugin
com.yilanwuyu
com.yinzara
com.yoctopuce.java
com.yourmediashelf.fedora
com.yourmediashelf.fedora.akubra
com.yubico.java
com.zanox.vertx
com.zaubersoftware.gnip4j.documentation
com.zaubersoftware.gnip4j.mule
com.zaubersoftware.maven.skins
com.zavakid
com.zenika.wicket.contrib
com.zenjava.zen-resources
com.zenuevo.pusher
com.zenuevo.simkit
com.zimmem
com.zimory.ldapunit
com.zsoltfabok
com.zwitserloot
commons-graph
commons-http
commons-i18n
commons-jux
commons-messenger
commons-sql
commons-threadpool
commons-util
commons-xo
conduit
congomongo
conjure-core
continuum
couchbase-clj
crouton
cryptix
cssparser
cz.advel.jbullet
cz.coroptis.coidi
cz.cvut.fit.maven
cz.jiripinkas
cz.jirutka.maven
cz.jirutka.rsql
cz.jirutka.unidecode
cz.mallat.uasparser
cz.muni
cz.muni.fi.mathml
cz.wicketstuff.boss
d-haven-eventbus
d-haven-mpool
dalms
datasift
datomic-schema
datumbazo
de.aaschmid.gradle.plugins
de.agilecoders.webjars
de.agilecoders.wicket.requirejs
de.akquinet.commons.imageio
de.akquinet.innovation.play2
de.akquinet.jbosscc.guttenbase
de.akquinet.jbosscc.latex
de.akquinet.jquery.plugins
de.almostintelligent
de.andrena.tools.nopackagecycles
de.bechte.junit
de.benediktmeurer.eui4j
de.benediktmeurer.gwt-slf4j
de.bigmichi1
de.caluga
de.cinovo
de.crowdcode.kissmda.app-examples
de.crowdcode.kissmda.core
de.cubeisland
de.cubeisland.maven.archetypes
de.danielbechler
de.davidbilge.spring
de.deinprogramm
de.dev-eth0
de.dev-eth0.dummycreator
de.devbliss.apitester
de.devbliss.paulparser
de.devsurf.injection.guice.aop
de.dr1fter
de.element34
de.empulse.eclipselink
de.enerko.commons
de.esailors.jenkins
de.extra-standard.procedures
de.fau.cs.osr.maven.plugins
de.felixschulze
de.felixschulze.android.test
de.felixschulze.maven.plugins.xcode
de.felixschulze.teamcity
de.fhg.igd
de.flapdoodle
de.flapdoodle.guava
de.flapdoodle.mongoom
de.fraunhofer.fokus.eject
de.fraunhofer.fokus.jackpot
de.fspengler.hudson.plugin
de.fspengler.hudson.pview
de.galimov
de.grundid.opendatalab
de.hasait
de.hashcode
de.helwich.junit
de.holisticon.archetypes
de.holisticon.util.tracee.outbound
de.hshannover.f4.trust
de.idos.updates
de.idyl
de.is24.hystrix
de.is24.maven.enforcer.rules
de.is24.util
de.jaide
de.jamba.hudson.plugin.wsclean
de.jarnbjo
de.javakaffee.net.vz.play.statsd
de.jensd
de.jiac.micro.platforms.java6
de.jodamob.android
de.jollyday
de.juplo
de.krsc.jsonpath
de.kune
de.l3s.boilerpipe
de.larmic.maven.plugins
de.leanovate.doby
de.learnlib.distribution
de.lightful.maven.drools.plugin
de.lightful.maven.plugins
de.lightful.maven.testing
de.lmu.ifi.dbs.jfeaturelib
de.lmu.ifi.dbs.utilities
de.malkusch
de.malkusch.localized
de.malkusch.soap-client-cache
de.malkusch.spring-lib
de.malkusch.validation
de.marcelsauer
de.martin-senne
de.matrixweb.hazelcast
de.matrixweb.json-config
de.matrixweb.maven.plugins.relocator
de.matrixweb.ne
de.matrixweb.nodejs
de.matrixweb.smaller-config
de.matrixweb.vfs
de.metalcon.utils
de.mhus.inka
de.mhus.karaf
de.mhus.sling.vaadin
de.micromata.jak
de.mindpipe.android
de.muntjak
de.mvbonline
de.no.number23
de.obqo.gradle
de.opal-project
de.oscillation.gwt
de.oscillation.maven
de.paymill
de.perdian.apps.beandumper
de.perdian.apps.devlauncher
de.piratech
de.plushnikov.intellij
de.plushnikov.maven.plugin
de.pribluda.android
de.psdev.slf4j-android-logger
de.quaddyservices.mvn.plugin.unused
de.quippy
de.regnis.q.sequence
de.sandroboehme
de.sandroboehme.lesscss
de.schlichtherle.glassfish
de.scrum-master
de.shadowhunt
de.shadowhunt.maven.plugins
de.skiptag
de.skuzzle
de.softwareforge
de.softwareforge.tools
de.spinscale
de.stefanteitge
de.taimos.ldjson
de.taimos.semi
de.teiesti.postie
de.teiesti.proxy
de.theappguys
de.theess.juxy
de.thetaphi
de.thomasasel
de.tudarmstadt.langtech.substituter.twsi
de.tudarmstadt.ukp.dkpro.statistics
de.tudarmstadt.ukp.jwktl
de.tudarmstadt.ukp.shibhttpclient
de.twentyeleven.bundled
de.twentyeleven.unitprofile
de.u-mass
de.uni-koblenz.ist
de.uni-potsdam.hpi.jerasure
de.uni-wuerzburg.coboslab
de.uniwue.dmir.heatmap
de.uni_leipzig.asv.toolbox
de.vandermeer
de.waldheinz
de.xypron.jcobyla
de.xypron.statistics
de.xypron.ui
decorutils
degel-clojure-utils
deview
die-roboter
directory-clients
dk.aeai
dk.apaq.crud.jpa
dk.apaq.vaadin.addon
dk.apaq.vfs
dk.apaq.webkit
dk.i1.diameter
dk.jacobve.maven.archetypes
dk.kewill.thirdpartymavencentral
dk.tbsalling
doccheck
domify
drift
drools-examples
dsabanin
dsh-vocabulary
edenlib
edtftp
edu.arizona.sista
edu.chop.research
edu.clemson.cs.resolve
edu.cmu.cs
edu.cmu.lti.oaqa.ecd
edu.cmu.lti.oaqa.openqa
edu.emory.mathcs
edu.fhda
edu.gatech.gtri.bk-tree
edu.gatech.gtri.orafile
edu.gatech.gtri.string-metric
edu.iu.ul.maven.plugins
edu.stanford.ppl
edu.uci.ics
edu.ucla.mbi.imex
edu.umd
edu.upc.dama
edu.usf.cims
edu.usf.messageservice
edu.vanderbilt.isis
edu.vt.middleware.maven.plugins
edu.washington.cs.knowitall.openie
edu.washington.cs.types.jsr308
edu.wpi.rail
ee.quest
emberio
emf-xsd-sdk
ervacon
es.arcadiaconsulting.graylog2
es.cenobit.struts2.json
es.cenobit.vraptor
es.csic.iiia.bms
es.klicap.sonar
es.ucm.fdi.grasia.faerie.archetypes
es.uib
es.upm.dit.gsi
es.upm.dit.gsi.shanks
es.usc.citius.common
etcd-clojure
eu.adlogix.com.google.api.ads.dfp
eu.anmore.mvpdroid
eu.aylett.prepackaged
eu.cedarsoft
eu.codearte.duramen
eu.danieldk.dictomaton
eu.danieldk.leveldb
eu.danieldk.nlp.jitar
eu.dicode-project
eu.eu-emi.security
eu.fispace
eu.franzoni
eu.ginere
eu.hansolo
eu.hansolo.enzo
eu.hurion.vaadin.heroku
eu.icolumbo.breeze
eu.lestard
eu.limetri.client.lib
eu.lindenbaum
eu.lp0.slf4j
eu.mais-h.mathsync
eu.matthiasbraun
eu.miman.comm.arduino
eu.miman.forge.plugin.util
eu.nets.oss.jetty
eu.nets.oss.maven
eu.piotrbuda
eu.somatik.serviceloader-maven-plugin
eu.unicore
eu.webtoolkit
excalibur-cli
excalibur-collections
excalibur-component-examples
excalibur-component-tests
excalibur-concurrent
excalibur-configuration
excalibur-containerkit
excalibur-extension
excalibur-i18n
excalibur-instrument-manager
excalibur-instrument-manager-interfaces
excalibur-io
excalibur-logger
excalibur-monitor
excalibur-mpool
excalibur-naming
excalibur-sourceresolve
excalibur-store
excalibur-util
excalibur-xmlutil
exml
exo-weblogic
exolabcore
expectations
factual
fesi
fi.evident.elasticsearch
fi.evident.lokki
fi.jpalomaki.markdown
fi.jpalomaki.ssh
fi.luontola.buildtest
fi.solita.datatree
fi.solita.json-migraine
filemap
filesystem-trie
flatland
flox
fm.last.commons.hive.serde
fogus
formproc
fr.arpinum
fr.avianey.modjo
fr.dvilleneuve.android
fr.figarocms
fr.foop.parsers
fr.greweb
fr.ifremer.wao
fr.inria.jfilter
fr.inria.minibus
fr.liglab.jlcm
fr.loof.fonzie
fr.loof.logeek
fr.marcwrobel
fr.mastah.maven.plugin
fr.njin
fr.norad.core
fr.norad.jaxrs.oauth2
fr.norad.logback.prettier
fr.norad.operating.system.specific
fr.norad.parent
fr.norad.servlet.sample.html.template
fr.norad.typed.command.line.parser
fr.norsys.asoape.it
fr.opensagres.maven.plugins
fr.opensagres.mongodb
fr.opensagres.xdocreport.itext-gae
fr.opensagres.xdocreport.sfntly
fr.pilato.spring
fr.ujm.tse.lt2c.satin
fr.vekia.tools
fr.w3blog
fr.xebia.management
fr.xebia.maven.plugins
fr.xebia.springframework
fr.xebia.web
fr.xebia.web.extras
gabriel
genjar
geocoder-clj
gg.pistol
github.com.taconaut
gloss
gov.nih.nlm.nls.lvg
gov.nist.math.jama
gr.abiss.js
gr.abiss.md4j
gr.abiss.mvn.plugins
gr.abiss.xcluder
gr.spinellis.ckjm
gr.xe
graphlayout
greenhopper
grizzly-cachetest
guru.nidi.maven.plugins
guru.nidi.raml
guzheng
hellonico
herolabs
hexdump
hiccup
hm.binkley
honeysql
hr.helix
http.async.client
HTTPClient
hu.netmind.beankeeper
hu.paalgyula
hu.webhejj
hudson.plugin
hudson.plugins.bamboo
hudson.plugins.cmake
hudson.plugins.copyProjectLink
hudson.plugins.dimensionsscm
hudson.plugins.filesystem_scm
hudson.plugins.jdepend
hudson.plugins.klaros
hudson.plugins.libvirt
hudson.plugins.memegen
hudson.plugins.reviewboard
hudson.plugins.sctmexecutor
hudson.plugins.sloccount
hudson.plugins.utplsql
hudson.queueSorter
hyperion
hystrix-event-stream-clj
i18nlog
ibm-security
id.web.michsan.csimulator
id.web.michsan.praytimes
ie.omk
ij
il.ac.technion.cs.ssdl
im.amomo.leveldb
im.amomo.volley
im.chic.crypto
im.chit
im.tym.wraop
in.anjan.struts2-webflow
in.codehub
in.kiranbagul
in.tombo
inflections
info.akshaal
info.bethard
info.ganglia.jmxetric
info.gehrels.voting
info.ineighborhood
info.johtani
info.kinumi
info.leadinglight
info.magnolia.activation
info.piwai.rockslide
info.rsdev.xb4j
info.silin
info.solidsoft.gradle.pitest
informa
innuendo
interval-tree
io.advantageous.ddp
io.advantageous.guicefx
io.airbrake
io.airlift.discovery
io.airlift.tpch
io.apigee
io.apigee.lembos
io.appium
io.backchat.websocket
io.bernoulli
io.bigwig
io.blep
io.ckite
io.clickity
io.dylemma
io.fabric8.itests
io.fabric8.security.sso.activemq
io.fabric8.security.sso.client
io.fabric8.tooling.testing
io.fastjson
io.fluxx
io.gatling.uncommons.maths
io.generators
io.github.axxiss.android
io.github.bit-man
io.github.cheddar
io.github.eddieringle.android.libs.andicons
io.github.exaberries
io.github.huherto
io.github.ibuildthecloud
io.github.jnasmartcardio
io.github.jpasearch
io.github.kohsah
io.github.mkhanal
io.github.mvpotter
io.github.nicolasstucki
io.github.rmuhamedgaliev
io.github.rmuhamedgaliev.errorresolver
io.github.ryan-za
io.github.shuttlelang
io.github.stephenc.maven
io.github.tomykaira
io.ifar.dw-goodies
io.ifar.shiro-jdbi-realm
io.ino
io.iron.ironmq
io.iron.ironworker
io.jdev.address
io.jdev.html2js
io.joynr
io.joynr.java.android
io.justrudd
io.justrudd.datasources
io.justrudd.leveled
io.lanau.framework.modules.backend.aspect
io.lanau.framework.modules.backend.batch
io.lanau.framework.modules.backend.cache
io.lanau.framework.modules.backend.core
io.lanau.framework.modules.backend.messaging
io.lanau.framework.modules.backend.persistence
io.lanau.framework.modules.backend.reporting
io.lanau.framework.modules.backend.ws
io.lanau.framework.tools.eclipselinkstaticweavemavenplugin
io.latent
io.leon
io.mola.galimatias
io.niowire
io.orchestrate
io.ous
io.postmaster
io.prometheus
io.prometheus.client
io.pst.mojo
io.sensesecure
io.tesla.aether.test
io.tesla.dropwizard
io.tesla.dropwizard.sisu
io.tesla.nexus.plugins
io.tesla.okhttp
io.tesla.profile
io.tesla.sisu
io.tesla.sitebricks
io.tesla.tycho
io.thekrakken
io.trygvis.appsh
io.trygvis.trello4j
io.undertow.build
io.undertow.jastow
io.useless
io.webservices.api
io.zman
ir.cafebabe
ir.cafebabe.ninja
it.amattioli.archetypes
it.anyplace.web
it.atcetera
it.cnr.isti.domoware
it.concept.pin
it.cosenonjaviste
it.dontesta.sugarcrm.client.soap
it.grabz.grabzit
it.javalinux.sibilla.plugins
it.sauronsoftware.cron4j
it.sephiroth.android.library.exif
it.sephiroth.android.library.media
it.session.maven.plugins
it.sk.alfresco
it.svario.xpathapi
it.tidalwave
it.tidalwave.bluemarine
it.tidalwave.bluemarine.boot
it.tidalwave.fork.com.jayway.maven.plugins.android.generation2
it.tidalwave.infoglueexporter
it.uniroma1.dis.wsngroup.gexf4j
it.yobibit
ivory
jackcess
jaimbot
jardiff
jarohen
jarsync
jasper-jsr199
java2html
javaconfig
javadb
javasim
javax.javaee
javax.money
javax.net.websocket
javax.transaction.cdi
javax.usb
javazoom
jboss.jaxbintros
jboss.jbossws-framework
jboss.jbossws-jdk14
jboss.jbossws-spi
jboss.maven-archetypes
jboss.remoting
jcharts
jcommon
jcoverage
jcraft
jcs-javagroups
jcvsii
jdo
jdring
jenkins.plugin.assembla
jenkins.plugins
jep
jepi
jersey
jface
jfreechart
jhunlang
jintention
jiraph
jisp
jlibdiff
jmeter
jmml
jmscts
jmsn
joodo
jp.ac.waseda
jp.ac.waseda.cs.washi
jp.co.cyberagent.android.gpuimage
jp.co.worksap.jax_rs
jp.co.worksap.message.wrapper
jp.co.worksap.oss
jp.dodododo
jp.go.aist.six.util
jp.go.aist.six.vuln
jp.gr.java_conf.kazsharp
jp.ikedam.jenkins.plugins
jp.joao
jp.mixi
jp.sf.amateras
jp.skypencil.config
jp.skypencil.java-diff-utils
jp.sourceforge.spring-ext
jp.studyplus.android.sdk
jp.takar2ru
jp.tomorrowkey
jp.tomorrowkey.gradle.notifier
jp.vmi
jpl
jpox-dbcp
jpox-enhancer
jpox-java5
jreg
jrexx
jrobin
jsf-extensions
jsptags
jstyle
junit-doclet
juno
jwebunit
jxta
jzlib
kastermastandard
kawa
klojoule
kohsuke
kr.co.vcnc.haeinsa
kxml
lamina
lein-ancient
lein-beanstalk
lein-catnip
lein-clr
lein-conjure
lein-droid
lein-embongo
lein-fail-fast
lein-generate
lein-groovyc
lein-haml-sass
lein-light
lein-lobos
lein-mangoes
lein-newnew
lein-pjotest
lein-profiles
lein-ring
lein-runproject
lein-tag
lein-test-out
lein-webapp-template
leiningen
li.rudin.bootstrap
li.rudin.pid
li.rudin.svgdatabind
limelight
link
log4unit
lpg.runtime
lt.velykis.maven
ly.count
magicGball
mailaram
maps.hudson.plugins
markdown-clj
masai
math.geom2d
maven-javanet-plugin
maven-new
maven-validator
maxq
mcav
mckoi
me.breidenbach
me.elrod
me.figo
me.franfernandez
me.grison
me.lachlanap.config
me.lachlanap.lct
me.legrange
me.loki2302
me.normanmaurer.maven.autobahntestsuite
me.normanmaurer.niosmtp
me.qmx.jitescript
me.qmx.vraptor-authz
me.shaftesbury
me.shakiba.cambridge
me.shakiba.guice-config
me.shakiba.jdbi
me.shakiba.jsonrpc
me.shakiba.og4j
me.shakiba.readr
me.shenfeng
me.tatarka
me.tatarka.rxloader
me.tinhtruong.gradle.plugin
me.xuender
merlin-developer
messenger
metis
migratus
mlehman
mm-mysql
mm.mysql
mobi.cwiklinski
mockmaker
modulo11
mongofinil
mrj
mstor
mx.bigdata.cfdi
mx.bigdata.datalib
mx.bigdata.jcalais
mx.bigdata.streaming
mx.bigdata.t4j
mx.openpay
name.finsterwalder
name.lakhin.eliah.projects.papacarlo
name.mitterdorfer.perlock
name.stadig
native-deps
neko
net.abhinavsarkar
net.adamcin.granite
net.adamcin.granite.client
net.adamcin.sling
net.agkn
net.alchim31
net.alchim31.runner
net.alchim31.vscaladoc2
net.amrhassan
net.andrebrov
net.anzix
net.anzix.android
net.anzix.aws
net.anzix.maven
net.augeas
net.automatalib.distribution
net.avh4.clj
net.avh4.data
net.avh4.data.per
net.avh4.ideal.data
net.avh4.jrspec
net.avh4.math
net.avh4.mvn.archetype
net.avh4.rpg.generators
net.avh4.test
net.avh4.util.di
net.avh4.util.socket
net.awired.core
net.awired.jscoverage
net.awired.logback.prettier
net.bankras
net.bendlas.ring
net.bluefen
net.bobosse
net.bostrt.gwt
net.box
net.bpiwowar
net.bull.javamelody
net.cafeto.queryserialize
net.carlosgsouza
net.cgrand
net.champemont.jean.hogancompile
net.chocolapod
net.chronakis.tiles-dynamic
net.coacoas.gradle
net.connectedcaching
net.coobird.gui.simpleimageviewer4j
net.customware.confluence.plugin
net.customware.confluence.plugin.google.calendar
net.customware.confluence.plugin.tracking
net.customware.confluence.reporting
net.customware.gwt.presenter
net.customware.liquibase
net.databinder.herald
net.dataforte.doorkeeper
net.defn.ring
net.devlab722
net.digitaltsunami
net.diibadaaba.zipdiff
net.distilledcode.maven
net.disy.htmlunit
net.disy.prototype
net.dmitriyvolk.maven.plugins
net.dongliu.apk-parser
net.dongliu.cache
net.dongliu.vcdiff
net.dorzey.templatepopulator
net.dynamic-tools
net.dynamic-tools.javascript.dependencymanager
net.dynamic-tools.javascript.maven
net.dynamic_tools
net.dynamic_tools.javascript.dependencymanager
net.dynamic_tools.javascript.maven
net.ealden.gradle.plugins
net.edzard
net.eledge
net.elehack.maven.plugins
net.emaze
net.energyhub
net.erdfelt.android
net.ettinsmoor
net.eunjae.android.aevent
net.eunjae.android.modelmapper
net.eusashead.spring
net.fckeditor
net.featurist
net.floatingsun
net.formio
net.fortuna.ical4j
net.froelund
net.ftlines.wicket-cdi
net.ftlines.wicket-source
net.ggtools.junit
net.gini.dropwizard
net.hamnaberg.json
net.heartsavior
net.hockeyapp.android
net.htmlparser
net.incongru
net.innig.sweetxml
net.isanchez
net.israfil
net.israfil.cli
net.ja731j.bukkit
net.jakobnielsen
net.jakubholy.jeeutils
net.jangaroo.com.codecatalyst
net.jangaroo.com.sencha
net.jangaroo.org.requirejs
net.java.abeille
net.java.dev.ajax4jsf
net.java.dev.appframework
net.java.dev.designgridlayout
net.java.dev.eval
net.java.dev.faces-chain
net.java.dev.flexdock
net.java.dev.jaxb2-commons
net.java.dev.msv.datatype.xsd
net.java.dev.nimbus
net.java.dev.scenegraph
net.java.dev.urlrewrite
net.java.dev.xadisk
net.java.dev.xwork-optional
net.java.excelbundle
net.java.hulp.i18ntask
net.java.jawr
net.java.jogl
net.java.jutils
net.java.maven-incremental-build
net.java.msrp
net.java.sigtest
net.java.xadisk
net.javacrumbs.hamcrest-logger
net.javacrumbs.rest-fire
net.jawr.dwr
net.jcip
net.jexler
net.jini.lookup
net.johnluetke.WeatherAPI
net.jp.saf.http.cookie
net.jsunit
net.ju-n.auto-instrument
net.ju-n.benchmark
net.ju-n.bonita.connectors
net.ju-n.compile-command-annotations
net.ju-n.maven.doxia
net.karneim
net.kierenb
net.kilger.mockins
net.killa.kept
net.kindeditor
net.kolotyluk.java
net.kotek
net.krazyweb
net.ladstatt
net.lariverosc
net.leanix
net.lessy
net.lightbody.bmp
net.lightoze.errbit
net.lightoze.gwt-i18n-server
net.lkrnac.lib
net.lkrnac.libs
net.lo2k
net.logstash.log4j
net.logstash.logback
net.lshift
net.lshift.javamail
net.ltgt.gradle
net.ltgt.guice
net.ltgt.gwt.maven
net.mircomacrelli
net.mttechsolutions
net.nczonline.web
net.netheos
net.nikore.etcd
net.nisgits.gradle
net.nodebox
net.noerd
net.northfuse.sfop
net.officefloor.package
net.oneandone.maven.poms
net.orfjackal.nestedjunit
net.orfjackal.specsy
net.peachjean.confobj
net.peachjean.differentia
net.peachjean.modularwebapp
net.peachjean.mojo.pegdown
net.peachjean.overeasy
net.peachjean.restmx
net.peachjean.slf4j.mojo
net.praqma
net.pravian
net.quux00.simplecsv
net.rcarz
net.rdrei.android.dirchooser
net.reactivecore
net.redhogs.config
net.redhogs.cronparser
net.redhogs.sprawler
net.rgielen
net.ripe.ipresource
net.samuelcampos
net.sf.a2j
net.sf.advanced-gwt
net.sf.aislib
net.sf.aislib.goodies
net.sf.albermojoplugin
net.sf.appinfo
net.sf.assimilate
net.sf.asteriskjava
net.sf.autodao
net.sf.beanpot
net.sf.beanrunner
net.sf.beezle.maven.plugins
net.sf.beezle.ssass
net.sf.bioutils-proteo
net.sf.biweekly
net.sf.blunder
net.sf.brunneng.fusie
net.sf.brunneng.jom
net.sf.btb
net.sf.cobol2j
net.sf.cocmvc
net.sf.common-util
net.sf.cotta.ftp
net.sf.cotta.website
net.sf.dbfit
net.sf.dbinit
net.sf.dbmonster
net.sf.debian-maven
net.sf.delicious-java
net.sf.dnsjava-osgi
net.sf.dobo
net.sf.dynpageplus
net.sf.excha
net.sf.fax4j
net.sf.fck-faces
net.sf.filepiper
net.sf.gnasher
net.sf.ha-jdbc
net.sf.hermesftp
net.sf.hulp.meas
net.sf.ipsedixit
net.sf.itcb.addons.cache
net.sf.itcb.addons.monitoring
net.sf.itcb.extension.jaxb
net.sf.itcb.extension.mojo
net.sf.j8583
net.sf.jabb
net.sf.jack4j
net.sf.jadretro
net.sf.jagg
net.sf.jaggregate
net.sf.jason
net.sf.javaanpr
net.sf.javaclub
net.sf.javafeedparsercommon
net.sf.javaprinciples.build
net.sf.javaprinciples.modelling
net.sf.jchart2d
net.sf.jcharts
net.sf.jcmdlineparser
net.sf.jcommon
net.sf.jdbc-wrappers
net.sf.jdds
net.sf.jett
net.sf.jexample
net.sf.jfasta
net.sf.jfastcgi
net.sf.jga
net.sf.jgap
net.sf.jguiraffe
net.sf.jinterflex
net.sf.jipcam
net.sf.jlogic
net.sf.jlynx
net.sf.jmgf
net.sf.jodreports
net.sf.joost
net.sf.jpa-queryfier
net.sf.jsequnit
net.sf.jsonunicode
net.sf.jsqlparser
net.sf.jtables
net.sf.jtreemap
net.sf.jyntax
net.sf.lastjcl
net.sf.layoutparser
net.sf.ldaptemplate
net.sf.lightair
net.sf.lightairmp
net.sf.locale4j
net.sf.m2-javafxc
net.sf.madp
net.sf.matrixjavalib.build
net.sf.maven-properties-enum-plugin
net.sf.mavenjython
net.sf.mavenjython.test
net.sf.meka
net.sf.mgaip
net.sf.michael-o.dirctxsrc
net.sf.minuteproject
net.sf.mmm
net.sf.moholy
net.sf.mongojdbcdriver
net.sf.morph
net.sf.mvc-prototype
net.sf.nebular
net.sf.nomin
net.sf.ntru
net.sf.offo
net.sf.ofx4j
net.sf.openymsg
net.sf.perf4cdi
net.sf.practicalxml
net.sf.prefixedproperties
net.sf.probin
net.sf.py4j
net.sf.qdwizard
net.sf.randomjunit
net.sf.relish
net.sf.reportengine
net.sf.robocode
net.sf.rubycollect4j
net.sf.sahi
net.sf.seaf.mojo
net.sf.seam.perf4j
net.sf.seleniumjt
net.sf.serfj
net.sf.sojo
net.sf.sparta-spring-web-utils
net.sf.spring-json
net.sf.sprockets
net.sf.squirrel-sql.cli
net.sf.squirrel-sql.translations
net.sf.ssg.tools
net.sf.sugar.fspath
net.sf.sugar.scl
net.sf.textile4j
net.sf.triemap
net.sf.ujac
net.sf.webdav-servlet
net.sf.webtestfixtures
net.sf.xenqtt
net.sf.xisemele
net.sf.yac-io
net.sigmalab
net.simonvt.menudrawer.sample
net.sinofool
net.smacke
net.sourceforge.addressing
net.sourceforge.andspidclient
net.sourceforge.argo
net.sourceforge.argparse4clj
net.sourceforge.bpmn
net.sourceforge.cardme
net.sourceforge.chopchophttpclient
net.sourceforge.ckjm
net.sourceforge.cruisecontrol
net.sourceforge.dita-ot
net.sourceforge.html5valdialect
net.sourceforge.javaocr
net.sourceforge.javaocr.demos
net.sourceforge.jcalendarbutton
net.sourceforge.jdatepicker
net.sourceforge.jena
net.sourceforge.jenesis4java
net.sourceforge.jeval
net.sourceforge.jmatio
net.sourceforge.jmol
net.sourceforge.jpaxjc
net.sourceforge.jpp
net.sourceforge.jsdialect
net.sourceforge.jsdp
net.sourceforge.jsf-comp
net.sourceforge.jweather
net.sourceforge.mailprobe
net.sourceforge.maven-jlex
net.sourceforge.maven-taglib
net.sourceforge.mikha-web-utils
net.sourceforge.mstparser
net.sourceforge.mvn-dp-plugin
net.sourceforge.mysources.thinkinjava4
net.sourceforge.nrl
net.sourceforge.openai
net.sourceforge.ota-tools.schema
net.sourceforge.ota-tools.schema.xmlbeans
net.sourceforge.pagesdialect
net.sourceforge.pah
net.sourceforge.pro-grade
net.sourceforge.queried
net.sourceforge.rafc
net.sourceforge.rapidprops
net.sourceforge.rcache
net.sourceforge.rconed
net.sourceforge.spanishbanklib
net.sourceforge.svg2ico
net.sourceforge.tapestrytestify
net.sourceforge.tapestryxpath
net.sourceforge.tedhi
net.sourceforge.tuio
net.sourceforge.urin
net.sourceforge.werken-opt
net.sourceforge.wicketwebbeans.databinder.examples
net.sourceforge.writexml
net.sourceforge.xazzle
net.sourceforge.xbis
net.spantree.namegenius
net.stamfest
net.stangenberg
net.stax
net.stepniak.picheese
net.stickycode.rs
net.stickycode.stile
net.sue445
net.thejavashop
net.thejeearchitectcookbook
net.thucydides.kendoui
net.tietema.versioning
net.timothyhahn
net.timothyhahn.crane
net.tirasa.openjpa-azure
net.tleproject
net.toften
net.trajano
net.trajano.archetype
net.trajano.commons
net.trajano.gasprices
net.trajano.maven.doxia
net.trajano.maven.skins
net.trajano.sonar.plugins
net.trajano.wagon
net.trustyuri
net.twibs
net.twonky
net.unicon.persondir
net.unicon.springframework
net.unit8.sastruts
net.unit8.sastruts.oauth
net.unit8.wscl
net.urizone
net.usikkert.kouinject
net.uvavru.maven.plugin
net.vz.play.snapshot
net.vz.play.statsd
net.walend
net.wasdev.maven.parent
net.wasdev.wlp.ant
net.wasdev.wlp.maven
net.wasdev.wlp.maven.plugins
net.wessendorf.websocket
net.wouterdanes
net.wouterdanes.docker
net.xp-forge.sonar.plugins
net.xp-forge.xar
net.yankus
net.zcarioca.zcommons
net.zeroinstall
net._01001111
new.wimpi.telnetd
nf.fr.eraasoft
nl.bstoi.jersey.test-framework
nl.bstoi.poiparser
nl.cloudfarming.mojo
nl.esi.metis
nl.fizzit.maven.plugins
nl.garvelink.oss
nl.gridshore.nosapi
nl.ivonet
nl.ivonet.beanunit
nl.javadude.gradle.plugins
nl.javadude.scannit
nl.javadude.t2bus
nl.orange11.hippo.common
nl.pieni.maven.dependency-analyzer
nl.qbusict
nl.razko
nl.rug.search
nl.sijpesteijn.testing.fitnesse.plugins
nl.stevenhack.volley
nl.thebigb
nl.tranquilizedquality
nl.tweeenveertig
nl.tweeenveertig.csveed
nl.tweeenveertig.openstack
nl.ulso.sprox
nl.ypmamedia.googlefaces
no.arktekk.sbt
no.bekk.bekkopen
no.bekk.bekkopen.cde
no.difi.sdp
no.eirikb
no.found.elasticsearch
no.kantega
no.priv.garshol.duke
no.spid
no.twingine.hudson
no.uis.studinfo
no.uis.util
noir
norbert
nu.infinity
nu.pattern
nz.ac.auckland.groupapps.common
nz.ac.auckland.groupapps.javascript
nz.ac.auckland.integration.testing
nz.ac.auckland.jobs
nz.ac.auckland.morc
nz.ac.auckland.simple
nz.ac.auckland.stencil
nz.co.edmi
nz.co.rossphillips
nz.net.osnz.test
nz.net.ultraq.thymeleaf
nz.net.ultraq.web.lesscss
nz.net.ultraq.web.yuicompressor
nz.net.ultraq.yuicompressor
ofbcore
open-esb
opennms
oracle.toplink.essentials
org
org.99soft
org.99soft.commons
org.99soft.semweb
org.99soft.trudeau.math
org.abstractj.kalium
org.activiti.designer
org.aeonbits.owner
org.aerysoft.minimaven
org.afplib
org.agileclick.genorm
org.agileclick.slickxml
org.agileclick.ultramc
org.agileinsider
org.agileware
org.agilewiki.jaconfig
org.agmip.thirdparty
org.ahocorasick
org.aicer.hibiscus
org.akhikhl.gradle-onejar
org.akhikhl.rooty
org.akhikhl.wuff
org.alfresco.cmis.client
org.amcgala
org.anacoders.plugins
org.anadix.conditions
org.anarres.jdiagnostics
org.anarres.vfsjfilechooser
org.ancoron.common
org.ancoron.glassfish.asadmin
org.ancoron.glassfish.extender
org.ancoron.glassfish.samples.asadmin
org.ancoron.osgi.test
org.andromda.bootstrap.maven.plugins
org.andromda.bootstrap.templateengines
org.andromda.cartridges.support
org.andromda.maven
org.andromda.samples.onlinestore
org.andromda.thirdparty.jalopy
org.animatejsf
org.annolab.tt4j
org.apache-extras.cassandra-jdbc
org.apache-extras.qpid
org.apache.anakia
org.apache.apache.resources
org.apache.archiva.redback.components.modello
org.apache.aries.application.itest.twitter
org.apache.avalon.logkit
org.apache.camel.example
org.apache.camel.karaf
org.apache.camel.maven
org.apache.cocoon.all
org.apache.cocoon.archetype-block
org.apache.cocoon.archetype-parent
org.apache.cocoon.archetype-sample
org.apache.cocoon.archetype-webapp
org.apache.cocoon.sample
org.apache.coyote
org.apache.cxf.fediz.examples.webservice
org.apache.cxf.fediz.examples.wsclientWebapp
org.apache.cxf.fediz.examples.wsclientWebapp.webservice
org.apache.cxf.karaf
org.apache.cxf.services.sts
org.apache.cxf.xjc-utils
org.apache.directmemory.itests
org.apache.directory.buildtools
org.apache.directory.client.ldap
org.apache.directory.mavibot
org.apache.directory.server.http
org.apache.dvsl
org.apache.el
org.apache.excalibur.fortress.bean
org.apache.excalibur.fortress.examples
org.apache.excalibur.fortress.migration
org.apache.excalibur.fortress.platform
org.apache.excalibur.fortress.testcase
org.apache.excalibur.testcase
org.apache.flume.flume-ng-clients
org.apache.geronimo.applications.console
org.apache.geronimo.configs
org.apache.geronimo.daytrader.assemblies
org.apache.hadoop.contrib
org.apache.httpcore
org.apache.isis.skins
org.apache.jasper
org.apache.jdbm
org.apache.jspwiki
org.apache.juli
org.apache.karaf.cellar.samples
org.apache.karaf.demos.deployer.bundle
org.apache.karaf.demos.deployer.wrap
org.apache.karaf.eik.archetypes
org.apache.karaf.scheduler
org.apache.lucene.solr
org.apache.mahout.commons
org.apache.mahout.hadoop
org.apache.mahout.hbase
org.apache.mahout.jets3t
org.apache.mahout.kosmofs
org.apache.mahout.kosmosfs
org.apache.mahout.uncommons.math
org.apache.maven.continuum.jpox
org.apache.maven.its
org.apache.myfaces.extensions.validator
org.apache.npanday.its
org.apache.nutch
org.apache.oltu.jose
org.apache.openwebbeans.arquillian
org.apache.openwebbeans.build-tools
org.apache.poi.DELETE
org.apache.servicemix.activiti
org.apache.servicemix.assemblies
org.apache.servicemix.camel
org.apache.servicemix.features
org.apache.servicemix.logging
org.apache.servicemix.naming
org.apache.servicemix.samples.bridge-camel
org.apache.servicemix.transaction
org.apache.servicemix.war
org.apache.shale.extras
org.apache.shiro.tools
org.apache.sis
org.apache.sis.profiles
org.apache.sqoop.connector
org.apache.sqoop.execution
org.apache.sqoop.repository
org.apache.sqoop.submission
org.apache.struts.shale
org.apache.subversion
org.apache.texen
org.apache.thrift.tools
org.apache.tiles.autotag.plugin
org.apache.velocity.tools
org.apache.wicket.experimental.wicket7
org.apache.ws.schema
org.apache.ws.xmlrpc
org.apache.xml
org.apdplat
org.apidesign.bck2brwsr.ide.editor
org.apmem.tools
org.appverse.web.framework.archetypes.gwt
org.appverse.web.framework.archetypes.gwtproject
org.appverse.web.framework.archetypes.jsf2
org.appverse.web.framework.modules.backend.aspect
org.appverse.web.framework.modules.backend.batch
org.appverse.web.framework.modules.backend.core.api
org.appverse.web.framework.modules.backend.core.cache
org.appverse.web.framework.modules.backend.core.persistence
org.appverse.web.framework.modules.backend.core.persistence.eclipselink
org.appverse.web.framework.modules.backend.core.persistence.hibernate
org.appverse.web.framework.modules.backend.core.persistence.jpacore
org.appverse.web.framework.modules.backend.core.rest
org.appverse.web.framework.modules.backend.core.ws
org.appverse.web.framework.modules.backend.frontfacade.gwt
org.appverse.web.framework.modules.backend.frontfacade.gxt
org.appverse.web.framework.modules.backend.frontfacade.json
org.appverse.web.framework.modules.backend.messaging
org.appverse.web.framework.modules.backend.reporting
org.appverse.web.framework.modules.frontend.gwt.api
org.appverse.web.framework.modules.frontend.gwt.theme
org.appverse.web.framework.poms.tools.jpaddlgenerator.plugin
org.appverse.web.framework.tools.archetypes.gwtproject
org.appverse.web.tools.archetypegenerator
org.appverse.web.tools.jpaddlgenerator
org.appverse.web.tools.projectgenerator
org.arm4
org.arquillian.droidium
org.arquillian.protocol
org.arquillian.tck
org.arquillian.tck.container
org.artifactory
org.asmatron
org.atinject
org.atmosphere.jboss.as
org.atmosphere.org.timepedia.exporter
org.atomserver
org.atteo.urlhandlers
org.attoparser
org.avaje.jetty
org.avaje.moduuid
org.awake-file
org.awake-sql
org.awknet
org.axonframework.com.lmax
org.axsl.org.w3c.dom.svg
org.b1.pack
org.backlog4j
org.backuity
org.badiff
org.basecamp4j
org.basepom
org.basepom.maven
org.basex
org.batcha.gradle.plugins
org.batoo.common
org.beandiff
org.beangle
org.beangle.ioc
org.beangle.orm
org.beangle.test
org.beangle.tomcat
org.beanio
org.beanstalk4j
org.beer30
org.betteridiots.ddf
org.betteridiots.mojo
org.bidib.jbidib.com.vldocking
org.bidib.jbidib.eu.hansolo
org.bidib.jbidib.org.qbang.rxtx
org.biojava
org.bitbucket
org.bitbucket.bradleysmithllc.java-cl-parser
org.bitbucket.bradleysmithllc.regular-expression-proxy-compiler
org.bitbucket.b_c
org.bitbucket.cowwoc.servicelocator
org.bitbucket.davidmc24.mongodb.aggregate
org.bitbucket.fwilhelm
org.bitbucket.gaidhlig.passwordfield
org.bitbucket.googolplex.devourer
org.bitbucket.lp
org.bitbucket.miyakawa_taku
org.bitbucket.theromefather
org.bitlet
org.bitstrings.eclipse.m2e
org.bituf
org.bluestemsoftware.license.header
org.bluestemsoftware.open.eoa.engine.spring
org.bluestemsoftware.open.eoa.example.application.spring10
org.bluestemsoftware.open.eoa.ext.dependency
org.bodil
org.bomba-lang
org.boundbox
org.breizhbeans.thrift.tools
org.bsc.maven.plugin
org.bsc.processor
org.bubuabu.parallelrunner
org.buildsomethingawesome.lib
org.bushe
org.c64.attitude
org.cacoo4j
org.callbackparams
org.camunda.bpm.identity
org.camunda.bpm.javaee
org.canedata.module
org.carlspring
org.carrot2.labs
org.chafed
org.chalup
org.chalup.microorm
org.chalup.thneed
org.chasen.mecab
org.chboston.cnlp
org.cheffo
org.chorem.callao
org.chorem.pollen
org.christor
org.cip4.lib.jdf
org.cip4.lib.ptk
org.cip4.lib.xprinttalk
org.citygml4j
org.clevermore
org.clojars.aowongster
org.clojars.automata
org.clojars.caugmar
org.clojars.chapmanb
org.clojars.charles-stain
org.clojars.deadprogram
org.clojars.floriano.clj-tika
org.clojars.fukamachi
org.clojars.gardendb
org.clojars.gukjoon
org.clojars.jaceklach
org.clojars.jberg
org.clojars.jkk
org.clojars.kosii
org.clojars.krisajenkins
org.clojars.kyleburton
org.clojars.liquidz
org.clojars.llasram
org.clojars.mediocregopher
org.clojars.michaelblume
org.clojars.nakkaya
org.clojars.nodename
org.clojars.paul
org.clojars.pntblnk
org.clojars.racoon
org.clojars.slyphon
org.clojars.smallrivers
org.clojars.smee
org.clojars.sritchie09
org.clojars.torbjornvatn
org.clojars.trptcolin
org.clojure.gaverhae
org.cloudhoist.plugin
org.cloudsmith.stackhammer
org.clueweb
org.codeandmagic.android
org.codeartisans.android-toolbox
org.codeartisans.java
org.codeartisans.jsw-maven-plugin
org.codeartisans.qipki.clients
org.codeartisans.qipki.qipki-http
org.codeartisans.qipki.qipki-tools
org.codeconsole
org.codeconsole.sitemesh
org.codedoers.util
org.codeforamerica.open311
org.codehaus.annogen
org.codehaus.cake
org.codehaus.cuanto
org.codehaus.enunciate.archetypes
org.codehaus.fabric3.itest
org.codehaus.gmaven.support
org.codehaus.gmavenplus
org.codehaus.groovy.modules.groosh
org.codehaus.groovyfx
org.codehaus.guessencoding
org.codehaus.httpcache4j.clients
org.codehaus.httpcache4j.spring
org.codehaus.httpcache4j.uribuilder
org.codehaus.jcsp
org.codehaus.jstestrunner
org.codehaus.mojo.dbupgrade
org.codehaus.mojo.enchanter
org.codehaus.mvel
org.codehaus.plexus.examples
org.codehaus.sonar-plugins.android
org.codehaus.sonar-plugins.dotnet.tests
org.codehaus.sonar-plugins.fxcop
org.codehaus.sonar-plugins.plsqltoad
org.codehaus.sonar-plugins.resharper
org.codehaus.sonar-plugins.stylecop
org.codehaus.sonar-plugins.toxicity-chart
org.codehaus.sonar-plugins.visualstudio
org.codehaus.sonar.dotnet.fxcop
org.codehaus.sonar.dotnet.tests
org.codehaus.xfire.plugins
org.codehaus.xharness
org.codehaus.yfaces
org.codemonkey.simplejavamail
org.colllib
org.cometd.javascript
org.commonjava.aprox.tools
org.commonjava.arqas
org.commonjava.emb.event
org.commonjava.googlecode.markdown4j
org.commonjava.maven.assembly
org.commonjava.maven.cartographer
org.commonjava.maven.enforcer
org.commonjava.mimeparse
org.commonjava.redhat
org.commonjava.redhat.maven
org.commonjava.sshwrap
org.complykit
org.contract4j5
org.coosproject.build-tools.org.apache.felix
org.coosproject.build-tools.org.knopflerfish.ant
org.coosproject.build-tools.org.ops4j
org.cortx
org.coursera
org.crazycake
org.criteria4jpa
org.criticalsection
org.cryptonode.jncryptor
org.cssless
org.csveed
org.curjent
org.custommonkey.xmlunit
org.cyberneko
org.cyberneko.pull
org.daisy.bindings
org.daisy.pipeline.build
org.daisy.validation
org.danvk
org.dapacode.tree4j
org.daverog
org.deephacks.launcher
org.deephacks.streamql
org.deephacks.vals
org.devoxx4kids.bukkit.plugins
org.devunited
org.dihedron.zephyr
org.disges
org.dm.gradle
org.docbook
org.doctester
org.dodgybits.shuffle
org.dojotoolkit
org.drift-db
org.dspace.modules
org.dspace.modules.imscp
org.dspace.xmlui.concurrent
org.dspace.xmlui.eclipse
org.dspace.xmlui.ehcache
org.dspace.xmlui.jcs
org.dspace.xmlui.rhino
org.dtangler
org.duckapter
org.duineframework
org.duraspace.fcrepo-cloudsync
org.dyn4j
org.dynalang
org.easygson
org.easymetrics
org.ebaysf.web
org.eccosolutions.osaf.cosmo
org.echocat.jomon.maven.plugins
org.echocat.maven.plugins
org.echocat.rundroid
org.eclipse.core.filesystem
org.eclipse.core.filesystem.solaris
org.eclipse.core.filesystem.win32
org.eclipse.cvs
org.eclipse.ecf.core
org.eclipse.ecf.example.collab
org.eclipse.ecf.examples
org.eclipse.ecf.presence.collab
org.eclipse.ecf.provider.bittorrent
org.eclipse.ecf.provider.filetransfer
org.eclipse.ecf.provider.irc
org.eclipse.ecf.provider.msn
org.eclipse.ecf.provider.xmpp
org.eclipse.ecf.server
org.eclipse.ecf.telephony.call
org.eclipse.emf.mapping.ecore
org.eclipse.emf.mapping.ecore2ecore
org.eclipse.emf.mapping.ecore2xml
org.eclipse.emf.mapping.xsd2ecore
org.eclipse.emf.query.ocl
org.eclipse.emf.validation.ocl
org.eclipse.emf.validation.ui
org.eclipse.equinox.jsp
org.eclipse.equinox.launcher.carbon
org.eclipse.equinox.launcher.gtk.solaris
org.eclipse.equinox.launcher.motif.aix
org.eclipse.equinox.launcher.win32.win32
org.eclipse.equinox.launcher.wpf.win32
org.eclipse.equinox.preferences
org.eclipse.equinox.registry
org.eclipse.gmf.doc
org.eclipse.gmf.ecore
org.eclipse.gmf.runtime.common.ui.printing
org.eclipse.gmf.runtime.common.ui.services.dnd
org.eclipse.hudson.tools
org.eclipse.hyades.probekit.doc
org.eclipse.jdt.apt.pluggable
org.eclipse.jdt.compiler
org.eclipse.jdt.junit4
org.eclipse.jdt.launching
org.eclipse.jdt.source.macosx.carbon
org.eclipse.jetty.alpn
org.eclipse.jetty.example-async-rest
org.eclipse.jst.ejb.doc
org.eclipse.jst.j2ee.doc
org.eclipse.jst.j2ee.xdoclet
org.eclipse.jst.jsf.doc
org.eclipse.jst.jsf.facesconfig
org.eclipse.jst.jsf.standard
org.eclipse.jst.jsp.ui
org.eclipse.jst.pagedesigner.jsf
org.eclipse.jst.server.preview
org.eclipse.jst.server.ui
org.eclipse.jst.server.ui.doc
org.eclipse.jst.server.websphere
org.eclipse.jst.servlet.ui
org.eclipse.jst.standard
org.eclipse.jst.ws.axis
org.eclipse.jst.ws.axis.creation
org.eclipse.jst.ws.axis.ui.doc
org.eclipse.jst.ws.consumption.ui.doc
org.eclipse.jst.ws.creation
org.eclipse.jst.ws.creation.ejb
org.eclipse.jst.ws.doc
org.eclipse.mylyn
org.eclipse.mylyn.help
org.eclipse.mylyn.pde
org.eclipse.ocl.uml
org.eclipse.pde.doc
org.eclipse.pde.junit
org.eclipse.pde.ui
org.eclipse.platform
org.eclipse.platform.source.macosx.carbon
org.eclipse.platform.source.solaris.gtk
org.eclipse.platform.source.win32.win32
org.eclipse.platform.source.win32.wpf
org.eclipse.rcp
org.eclipse.rcp.source.aix.motif
org.eclipse.rcp.source.macosx.carbon
org.eclipse.rcp.source.solaris.gtk
org.eclipse.rcp.source.win32.win32
org.eclipse.rcp.source.win32.wpf
org.eclipse.swt
org.eclipse.swt.carbon
org.eclipse.swt.gtk.solaris
org.eclipse.swt.motif.aix
org.eclipse.swt.org.eclipse.swt.cocoa.macosx.4.3.swt
org.eclipse.swt.org.eclipse.swt.cocoa.macosx.x86_64.4.3.swt
org.eclipse.swt.org.eclipse.swt.gtk.aix.ppc.4.3.swt
org.eclipse.swt.org.eclipse.swt.gtk.aix.ppc64.4.3.swt
org.eclipse.swt.org.eclipse.swt.gtk.hpux.ia64.4.3.swt
org.eclipse.swt.org.eclipse.swt.gtk.linux.ppc.4.3.swt
org.eclipse.swt.org.eclipse.swt.gtk.linux.ppc64.4.3.swt
org.eclipse.swt.org.eclipse.swt.gtk.linux.s390.4.3.swt
org.eclipse.swt.org.eclipse.swt.gtk.linux.s390x.4.3.swt
org.eclipse.swt.org.eclipse.swt.gtk.linux.x86.4.3.swt
org.eclipse.swt.org.eclipse.swt.gtk.linux.x86_64.4.3.swt
org.eclipse.swt.org.eclipse.swt.gtk.solaris.sparc.4.3.swt
org.eclipse.swt.org.eclipse.swt.gtk.solaris.x86.4.3.swt
org.eclipse.swt.org.eclipse.swt.win32.win32.x86.4.3.swt
org.eclipse.swt.org.eclipse.swt.win32.win32.x86_64.4.3.swt
org.eclipse.text
org.eclipse.tycho.nexus
org.eclipse.ui.presentations
org.eclipse.uml2.codegen.ecore
org.eclipse.uml2.diagram.codegen
org.eclipse.uml2.examples
org.eclipse.uml2.examples.uml
org.eclipse.uml2tools
org.eclipse.wst.command.env.doc
org.eclipse.wst.doc
org.eclipse.wst.dtd.ui
org.eclipse.wst.dtdeditor.doc
org.eclipse.wst.html.ui
org.eclipse.wst.internet
org.eclipse.wst.javascript.ui
org.eclipse.wst.server.preview
org.eclipse.wst.server.ui
org.eclipse.wst.server.ui.doc
org.eclipse.wst.sse.doc
org.eclipse.wst.sse.ui
org.eclipse.wst.standard
org.eclipse.wst.web.ui
org.eclipse.wst.webtools.doc
org.eclipse.wst.wsdl.ui.doc
org.eclipse.wst.wsi
org.eclipse.wst.wsi.ui.doc
org.eclipse.wst.xml.ui
org.eclipse.wst.xmleditor.doc
org.eclipse.wst.xsdeditor.doc
org.eclipse.wtp
org.eclipse.xsd.mapping
org.edla
org.efaps.maven
org.ehcache
org.eigengo
org.eiichiro.ash
org.eiichiro.monophony
org.eluder.coveralls
org.eluder.jersey
org.enblom.time
org.encog
org.eprover
org.equilibriums.utils
org.esigate.maven
org.eu.ingwar.tools
org.everit.config
org.exoplatform.addons
org.exoplatform.doc
org.exoplatform.ecm.bp
org.exoplatform.ecm.dms
org.exoplatform.ecm.dms.ext.contentvalidation
org.exoplatform.ecm.dms.ext.contentvalidation.bp
org.exoplatform.ecm.workflow.bp
org.exoplatform.integration
org.exoplatform.tool
org.exoplatform.wcm
org.eyrie
org.fabrician.maven-plugins
org.facebook4j
org.fakereplace.fakereplace-google-collections
org.fcrepo.fixity
org.feijoas
org.fiirs
org.finra.datagenerator
org.finra.jtaf
org.fizmo
org.forgedbits
org.forgerock.maven.plugins
org.freecompany.redline
org.freeswitch.esl.client
org.freetle
org.freshcookies
org.fressian
org.fuin.archetypes
org.fusesource.coffeebar
org.fusesource.fabric.examples
org.fusesource.fabric.openshift
org.fusesource.fabric.security.sso.activemq
org.fusesource.fabric.security.sso.client
org.fusesource.hawtdb
org.fusesource.hawtjournal
org.fusesource.jms
org.fusesource.jvmassert
org.fusesource.rmiviajms
org.fusesource.stomp
org.fusesource.tooling.testing
org.fxmisc.easybind
org.fxmisc.richtext
org.fxmisc.undo
org.gaixie.jibu.web
org.gamio
org.gatein.captcha
org.gatein.cdi
org.gatein.doc
org.gatein.naming
org.gatein.web
org.gearman
org.gedcom4j
org.geonames
org.geowebcache
org.gitlab
org.gitorious.jcryptionspring
org.glassfish.cafe
org.glassfish.cdi
org.glassfish.copyright
org.glassfish.jdbc.jdbc-ra.jdbc30
org.glassfish.jdbc.jdbc-ra.jdbc40
org.glassfish.jersey
org.glassfish.jersey.bundles.repackaged
org.glassfish.jersey.examples.osgi-http-service
org.glassfish.jersey.incubator
org.glassfish.jersey.test-framework
org.glassfish.jsftemplating
org.glassfish.loadbalancer
org.glassfish.main.deployment.jsr-88
org.glassfish.main.extras.upgrade
org.glassfish.main.jdbc.jdbc-ra.jdbc30
org.glassfish.main.jdbc.jdbc-ra.jdbc40
org.glassfish.maven.plugin
org.glassfish.osgi-platforms
org.glassfish.scripting.jruby
org.glassfish.simplestub
org.glassfish.tyrus.archetypes
org.glassfish.tyrus.tests
org.glassfish.upgrade
org.glom.libglom
org.gmetrics
org.gnu
org.gnu.gettext
org.goduun
org.gparallelizer
org.gradlefx
org.graphwalker
org.greencheek.memcached
org.gridkit
org.gridkit.binary-extractors
org.gridkit.search
org.groovymud
org.groupcache
org.grouplens.grapht
org.grules
org.gstreamer
org.guzz
org.gwtmpv
org.gwtmultipage
org.hashtree.jbrainhoney
org.hawksoft
org.hbase
org.hbasene
org.hdfgroup
org.hdrhistogram
org.helmetsrequired
org.hibernate.orm.tooling
org.hidetake
org.hisrc.jscm
org.hobsoft
org.hoisted
org.holmes-validation
org.homedns.hondou
org.hornetq.rest
org.housecream.parent
org.hrodberaht.inject.extension
org.httpmock
org.httpobjects.demo
org.httpobjects.jackson
org.httpobjects.multipart
org.httpobjects.netty
org.httpobjects.proxy
org.httpunit
org.hudsonci.plugin
org.hypoport
org.iban4j
org.icroco
org.idpf
org.idris-lang
org.igniterealtime
org.igniterealtime.jbosh
org.ijsberg.iglu
org.imintel
org.imixs.application
org.immunogenomics.gl.voldemort
org.incava
org.infinitest
org.influxdb
org.ingini.mongodb
org.inightmare.jxmlizer
org.inigma
org.inigma.maven
org.iostreams
org.ireas.common
org.ireas.intuition
org.ireas.mediawiki
org.isoblue
org.italiangrid
org.j4j
org.jacex
org.jadira.cdt
org.jadira.cloning
org.jadira.jms
org.jadira.lang
org.jadira.maven
org.jadira.quant
org.jadira.refdata
org.jadira.reflection.cloning
org.jadira.scanner
org.jakubczyk
org.jamel.j7zip
org.jamppa
org.jasig.ehcache
org.jasig.portal.maven
org.jasig.portal.tools
org.jasig.portlet.archetype
org.jasig.portlet.athletics
org.jasig.portlet.campus
org.jasig.portlet.dining
org.jasig.portlet.map
org.jasig.portlet.proxy
org.jasig.portlet.simplecontent
org.jasig.ssp
org.jasig.ssp.util.importer
org.jasig.umobile.server
org.jasig.uportal
org.jasonjson
org.jassetmanager
org.jaudiotagger
org.java-websocket
org.javabits.maven.md
org.javaee
org.javaee-samples
org.javimmutable
org.jbake
org.jboss.aerogear.test
org.jboss.apiviz
org.jboss.arquillian.framework
org.jboss.arquillian.maven
org.jboss.as.archetypes
org.jboss.as.legacy.naming
org.jboss.as.quickstarts
org.jboss.ballroom
org.jboss.blacktie.plugins
org.jboss.cliresolver
org.jboss.dna.docs
org.jboss.ejb3.concurrency
org.jboss.ejb3.jndi
org.jboss.ejb3.statefulcache
org.jboss.envers
org.jboss.errai.forge
org.jboss.fpak
org.jboss.gravia
org.jboss.identity.idm.integration
org.jboss.jandex
org.jboss.javassist
org.jboss.jbossas.embedded.examples
org.jboss.jbossas.osgi
org.jboss.jbossas.snmp
org.jboss.jbossts.jta
org.jboss.jdeparser
org.jboss.jopr
org.jboss.jzipfile
org.jboss.logbridge
org.jboss.maven.archetypes
org.jboss.maven.extension.dependency
org.jboss.maven.plugins.enforcer.rules
org.jboss.maven.skins
org.jboss.mcann
org.jboss.migr.as
org.jboss.narayana.stm
org.jboss.narayana.txframework
org.jboss.native
org.jboss.osgi.blueprint
org.jboss.osgi.core
org.jboss.osgi.deployers
org.jboss.osgi.deployment
org.jboss.osgi.equinox
org.jboss.osgi.felix
org.jboss.osgi.hotdeploy
org.jboss.osgi.jaxb
org.jboss.osgi.jndi
org.jboss.osgi.serviceloader
org.jboss.osgi.wildfly
org.jboss.osgi.xb
org.jboss.osgi.xerces
org.jboss.overlord.dependencies.org.jboss.esb
org.jboss.papaki
org.jboss.picketlink
org.jboss.portal.cms
org.jboss.portal.identity
org.jboss.portal.web
org.jboss.portletbridge.examples.seam.booking
org.jboss.portletbridge.extensions.richfaces
org.jboss.portletbridge.testing.gatein
org.jboss.pressgang.ccms.services
org.jboss.resteasy.mobile
org.jboss.savara.dependencies.eclipse
org.jboss.savara.dependencies.pi4soa
org.jboss.seam.config
org.jboss.seam.cron
org.jboss.seam.examples-ee6.todo
org.jboss.seam.examples-ee6.ui
org.jboss.seam.render
org.jboss.seven2six
org.jboss.shrinkwrap.vfs3
org.jboss.slf4j
org.jboss.spec.javax.batch
org.jboss.spec.javax.enterprise.concurrent
org.jboss.spec.javax.json
org.jboss.spec.javax.websocket
org.jboss.teiid.teiid-test-integration
org.jboss.test.richfaces-selenium
org.jboss.tools
org.jboss.tools.runtime.plugins
org.jboss.vfs
org.jboss.webbeans.servlet
org.jboss.webbeans.tck
org.jboss.weld.arquillian.container
org.jboss.ws.plugins
org.jboss.ws.plugins.archetypes
org.jboss.xnio.netty
org.jbpm.jbpm4.dependencies.esb
org.jbpm.jbpm5
org.jbundle.app.dance
org.jbundle.app.picture
org.jbundle.app.tools
org.jbundle.javafx.config
org.jbundle.util.backup
org.jcodec
org.jconfig
org.jcors
org.jcraft
org.jdesktop.bsaf
org.jdesktop.swingx
org.jdice
org.jdice.calc
org.jdon
org.jdtaus.core.sax
org.jdtaus.editor
org.jenkins-ci.lib
org.jenkins-ci.tools
org.jenkinsci.plugins
org.jeromq
org.jetbrains
org.jetlang
org.jeuron
org.jfairy
org.jfree.chart
org.jfrog.aether
org.jglue.fluent-json
org.jibx.schema.org.docbook
org.jibx.schema.org.oasis_open
org.jibx.schema.org.opentravel.ws
org.jini.maven-jini-plugin
org.jitr
org.jiucai
org.jkee.gtree
org.jlibsedml
org.jmesa
org.jmetrix
org.jminix
org.jmonit
org.jmxtrans.agent
org.jmxtrans.embedded
org.jocl
org.jparsec
org.jpos
org.jproggy
org.jretrofit
org.jrobin
org.jruby.embed
org.jruby.plugins
org.jruby.rack
org.jruby.util
org.jruby.warbler
org.jsimpledb
org.jslipc
org.jstryker
org.jszip.maven
org.jtb
org.jtrfp
org.jumpmind.symmetric.schemaspy
org.junit.contrib
org.jvirtanen.config
org.jvirtanen.nassau
org.jvirtanen.nio
org.jvirtanen.value
org.jvnet.annotation-mock-builder
org.jvnet.ec2-sshd
org.jvnet.fix1600
org.jvnet.hudson.jackson
org.jvnet.hudson.plugins.fortify360
org.jvnet.hudson.plugins.mercurial
org.jvnet.hyperjaxb2.maven2
org.jvnet.jaxb.reflection
org.jvnet.jaxbhelp.maven2
org.jvnet.jax_ws_commons
org.jvnet.maven-antrun-extended-plugin
org.jvnet.maven-javanet-skin
org.jvnet.maven.incrementalbuild
org.jvnet.mcvp
org.jvnet.robust-http-client
org.jvnet.transcoder
org.jxmapviewer
org.jzkit
org.kamranzafar
org.kantega.htmltopdf
org.kathrynhuxtable.maven.skins
org.kathrynhuxtable.maven.wagon
org.kaveh.commons
org.kefirsf
org.kevoree.extra
org.kevoree.kcl
org.kevoree.maven
org.kevoree.maventools
org.kie.workbench
org.kielo.annotationscanner
org.kikini
org.kill-bill.billing.plugin.java
org.kitei.internal
org.kitei.testing
org.kloeckner.maven.plugin
org.klout4j
org.knallgrau.utils
org.kohsuke.args4j
org.kohsuke.gmaven
org.kohsuke.jetty
org.kohsuke.redstone
org.komamitsu
org.koshinuke
org.kt3k.gradle.plugin
org.kuali.cm
org.kuali.common.cm
org.kuali.common.ec2
org.kuali.common.threads
org.kuali.commons
org.kuali.db.sql
org.kuali.foundation.cm
org.kuali.jotm
org.kuali.maven
org.kuali.maven.cloudfront
org.kuali.maven.pom
org.kuali.maven.skins
org.kuali.maven.wagons
org.kuali.mobility
org.kuali.spring
org.kuali.student.deployments
org.kualigan.maven.skins
org.kubek2k.mockito.spring
org.l33tlabs.twl
org.la4j
org.latencyutils
org.leberrigaud.maven.plugins
org.leialearns
org.lestr
org.lestr.astenn.astenn-examples
org.lestr.astenn.astenn-examples.remote-implementation
org.liblouis
org.lightcouch
org.lindbergframework.web
org.lineargs
org.linuxmce
org.llrp
org.loadui
org.log4mongo
org.logicalshift
org.luxdb
org.lwes
org.lwsdo
org.m1theo
org.magicwerk
org.mantamq
org.mapfish.geo
org.mariadb.jdbc
org.masukomi
org.mat
org.mcavallo
org.mcraig
org.mdlavin
org.meanbean
org.mediawiki
org.mentaframework
org.meruvian.midas
org.metacsp
org.metawidget
org.metawidget.modules.android
org.metawidget.modules.static.html
org.metawidget.modules.static.jsp
org.metawidget.modules.static.spring
org.metawidget.modules.swing.jgoodies
org.metawidget.modules.swt
org.michaelgorski
org.mikeneck.graffiti
org.milyn.thirdparty
org.mirah.maven
org.mithrim.epf
org.mitre.cpe
org.mitre.dsmiley.httpproxy
org.mnode.mstor
org.mnode.newsagent
org.mnode.ousia
org.mobicents.commtesting
org.mobicents.examples.converged.docs
org.mobicents.external.appframework
org.mobicents.external.fmj
org.mobicents.external.jspeex
org.mobicents.external.opencsv
org.mobicents.jain
org.mobicents.jdocbook
org.mobicents.maven.plugins
org.mobicents.protocols.smpp
org.mobicents.protocols.ss7
org.mobicents.protocols.ss7.clock
org.mobicents.protocols.ss7.map.docs
org.mobicents.protocols.ss7.sccp.tools.twiddle.docs
org.mobicents.protocols.ss7.tools.traceparser
org.mobicents.protocols.stream.docs
org.mobicents.qa
org.mobicents.servers.diameter.tools
org.mobicents.servers.jainslee.1.0.tck
org.mobicents.servers.jainslee.tck
org.mobicents.servers.jainslee.tools.management
org.mobicents.servers.jainslee.tools.twiddle.docs
org.mobicents.servlet.seam
org.mobicents.servlet.sip.testsuite
org.mobicents.servlet.sip.weld
org.mobicents.slee.media
org.mobicents.testsuite
org.mod4j.patched
org.modeldriven
org.modeshape.docs
org.modeshape.examples
org.modeshape.web
org.mojavemvc
org.mongeez
org.mortbay.jetty.toolchain
org.moxiemocks
org.mozilla.javascript
org.mule.common
org.mule.ibeans
org.mule.munit
org.mule.mvel
org.mule.tools.cargo.integration-tests
org.mulesoft
org.mulgara
org.multimc
org.mushikago
org.mybatis.scripting
org.mynah
org.mythtv.android
org.nakedobjects.archetypes
org.nakedobjects.skins
org.nanocontainer.persistence
org.nanoko.coffee-mill
org.nanoko.libs
org.nanoko.playframework
org.nanopub
org.nefilim
org.neo4j.3rdparty.javax.ws.rs
org.neo4j.assembly
org.neo4j.drivers
org.neo4j.maven
org.neo4j.maven.skins
org.neociclo.accord
org.neovera.jdiablo
org.netbeans
org.netbeans.contrib.yenta
org.netbeans.nbbuild
org.netmelody.menodora
org.netmelody.tatin
org.netpreserve.openwayback.access-control
org.newhart
org.nfclabs
org.nickelproject
org.nightcode.yaranga
org.noggit
org.noregress
org.nosceon.natrolite
org.nosceon.titanite
org.notlocalhost.gradle
org.nqcx
org.nucleus8583
org.nuxeo
org.nuxeo.archetypes
org.nuxeo.correspondence
org.nuxeo.ecm
org.nuxeo.multi.tenant
org.nuxeo.rss.reader
org.nuxeo.shell
org.nuxeo.theme
org.objectstyle
org.objectweb.fractal.cecilia.examples
org.objectweb.fractal.fractaladl.juliac.tests-conf
org.objectweb.fractal.fractalexplorer.jgraph
org.objectweb.fractal.fractalgui
org.objectweb.fractal.fractaljar
org.objectweb.fractal.fractaljmx.examples
org.objectweb.mind
org.objectweb.think.minus.test
org.ocbkc.swift
org.ofbiz
org.officelaf
org.ognl
org.omg.dds
org.omg.profiles.uml14
org.omnaest.maven.plugin
org.onebusaway.plugins
org.onehippo.cms7.hst.client-modules
org.onehippo.ecm.hst.toolkit-resources.addon
org.openamf
org.opencredo.couchdb
org.openengsb.core.deployer
org.openengsb.core.ports
org.openengsb.core.proxy
org.openengsb.docs
org.openengsb.examples
org.openengsb.forks
org.openengsb.integrationtest
org.openengsb.integrationtest.wrapped
org.openengsb.itests
org.openengsb.labs.liquibase
org.openengsb.tooling
org.openengsb.tooling.archetypes.clientproject
org.openengsb.tooling.wsdl2dll
org.openfast
org.opengis.cite.teamengine
org.opengroup
org.openml
org.openqa.selenium
org.openqa.selenium.grid
org.openscm.kundo.kernel
org.opentripplanner
org.openurp.ws.services.teach
org.openwebtop.maven.plugins
org.openwms.plugins
org.opoo.press.maven.plugins
org.ops4j.gaderian.tools
org.ops4j.pax.cdi.fragment
org.ops4j.pax.confman
org.ops4j.pax.shiro.itest
org.ops4j.pax.wicket.samples
org.ops4j.pax.wicket.samples.blueprint.injection
org.ops4j.pax.wicket.samples.springdm
org.ops4j.pax.wicket.samples.springdm.injection
org.ops4j.peaberry
org.ops4j.resources
org.orcateam
org.orekit
org.org-libs
org.oscy
org.osframework.util
org.osgilab.testing
org.oss4ita.maven.superpom
org.oss4j.maven.master
org.outsideMyBox
org.overlord.rtgov.activity-management
org.overturetool.core.prettyprinting
org.overturetool.tools
org.ovirt.engine.sdk
org.ovirt.otopi
org.ovirt.ovirt-host-deploy
org.ovirt.vdsm-jsonrpc-java
org.ow2
org.ow2.chameleon.commons.bluecove
org.ow2.chameleon.commons.hamcrest
org.ow2.chameleon.commons.miglayout
org.ow2.chameleon.fuchsia.base
org.ow2.chameleon.fuchsia.base.json-rpc
org.ow2.chameleon.fuchsia.base.philips-hue
org.ow2.chameleon.fuchsia.importer.jaxrpc
org.ow2.chameleon.fuchsia.importer.jaxws
org.ow2.chameleon.fuchsia.importer.push
org.ow2.chameleon.fuchsia.testing
org.ow2.chameleon.management
org.ow2.chameleon.naming
org.ow2.chameleon.org.junit.paxexam
org.ow2.chameleon.rose.jms
org.ow2.chameleon.rose.jsonrpc.endpoint
org.ow2.chameleon.rose.rest
org.ow2.cmi.doc
org.ow2.easybeans.doc
org.ow2.fractal.distribution.doc
org.ow2.frascati.model
org.ow2.frascati.tinfi.juliet
org.ow2.frascati.transaction
org.ow2.jasmine.deployme
org.ow2.jasmine.jade.control
org.ow2.jasmine.jadort-samples
org.ow2.jasmine.probe.itests-modules
org.ow2.jonas.asm
org.ow2.jonas.assemblies.profiles.addons
org.ow2.jonas.autostart.plugin
org.ow2.jonas.jpaas.iaas-manager.providers
org.ow2.jonas.jpaas.jpaas-application-manager
org.ow2.jonas.jpaas.jpaas-environment-manager
org.ow2.jonas.jpaas.naming-manager
org.ow2.jonas.jpaas.resource-pool
org.ow2.jonas.jpaas.vm-configurator
org.ow2.kerneos.graniteds
org.ow2.legal
org.ow2.lewys
org.ow2.maven.skin
org.ow2.maven.skins
org.ow2.orchestra.reporting
org.ow2.petals.distribution
org.ow2.petals.dsb.distribution
org.ow2.petals.jsr181
org.ow2.scarbo
org.ow2.sirocco.vmware.vcloud
org.ow2.spec
org.ow2.spec.harness
org.ow2.util.annotation-processor
org.ow2.util.ant
org.ow2.util.base64
org.ow2.util.ee.builders
org.ow2.util.marshalling
org.ow2.util.merge
org.ow2.util.osgi-toolkit
org.ow2.util.xmlconfig
org.ow2.weblab.iterator
org.ow2.weblab.petals
org.ow2.weblab.portlets
org.ow2.weblab.tools
org.ow2.xlcloud.xms.console.themes
org.owasp.appsensor
org.owasp.passfault
org.owfs
org.papoose.plugins
org.paradox
org.patterntesting.samples
org.paylogic
org.pbit
org.pcollections
org.pelotom
org.pentaho.pentaho-commons
org.perfcake
org.pf
org.picketlink.extensions
org.picketlink.product
org.picocontainer.persistence
org.pitest.quickbuilder
org.piwik
org.plannerstack
org.ploin.pmf
org.ploin.web
org.plukh
org.poreid
org.powermock.modules.test.junit48
org.powermock.tests
org.projectlombok.test
org.projectodd
org.projectodd.sockjs
org.protobee.guice
org.psjava
org.puimula.voikko
org.pulloid
org.pustefixframework.maven.archetypes
org.pygments
org.qatools
org.qedeq.kernel
org.qianalyze.sample
org.quickserver
org.randombits.facade
org.reactfx
org.reactormonk
org.realityforge.gelf4j
org.realityforge.geolatte.jpa
org.realityforge.getopt4j
org.realityforge.guiceyloops
org.realityforge.gwt.cache-filter
org.realityforge.gwt.datatypes
org.realityforge.gwt.eventsource
org.realityforge.gwt.ga
org.realityforge.gwt.mmvp
org.realityforge.gwt.online
org.realityforge.gwt.property-source
org.realityforge.gwt.webpoller
org.realityforge.gwt.websockets
org.realityforge.jeo
org.realityforge.jeo.geolatte.jpa.eclipselink
org.realityforge.jml
org.realityforge.jndikit
org.realityforge.jsyslog-message
org.realityforge.proxy-servlet
org.realityforge.replicant
org.realityforge.rest.criteria
org.realityforge.rest.field_filter
org.realityforge.sqlshell
org.realityforge.ssf
org.red5
org.reddwarfserver.maven.plugin
org.redisson
org.redline-rpm
org.refact4j
org.reficio
org.regrest
org.rhq.etc
org.rhq.maven
org.rhq.maven.plugins
org.rhq.server
org.richfaces.cdk.maven-archetypes
org.richfaces.cdk.test
org.richfaces.commons
org.richfaces.docs
org.richfaces.docs.cdkguide
org.richfaces.docs.common-resources
org.richfaces.docs.faq
org.richfaces.docs.migration
org.richfaces.docs.photo_album_app_guide
org.richfaces.docs.realworld
org.richfaces.docs.userguide
org.richfaces.docs.xslt
org.richfaces.extensions
org.richfaces.test
org.riedelcastro
org.rifers
org.riftsaw
org.riftsaw.console
org.roaringbitmap
org.robobinding.plugins
org.robolectric.gradle
org.robotninjas
org.ronsmits
org.roribib
org.rosenvold.spring
org.rribbit
org.rundeck-plugins
org.safehaus.archaius
org.safehaus.guicyfig
org.safris.xml
org.sainfy
org.sakaiproject.hybrid
org.sakaiproject.maven.plugins
org.sakaiproject.pcservice
org.sakaiproject.reset-pass
org.sakaiproject.webservices
org.sameas
org.scala-lang.macro-paradise
org.scala-lang.virtualized.plugins
org.scala-tools.skins
org.scalaequals
org.scalafy
org.scalaperf
org.scalastic
org.scalawag.sbt.gitflow
org.scalaz.stream
org.schedulesdirect
org.schmant.hudson
org.scilab.forge
org.scode
org.scream3r
org.seleniumhq.selenium.fluent
org.seleniumhq.selenium.ide
org.seleniumhq.selenium.tests
org.semanticdesktop.aperture
org.settings4j
org.sevensource.wro4spring
org.shamdata
org.sharegov
org.sharengo.wikengo
org.shept
org.sidoh
org.signaut
org.silvertunnel-ng
org.simart
org.simplericity
org.simplericity.datadirlocator
org.sitoolkit
org.sitoolkit.archetype
org.sjmvc
org.skfiy
org.skife
org.skife.cli
org.skife.com.typesafe.config
org.skife.gressil
org.skife.jetty.v9
org.skife.maven
org.skife.ssh
org.skife.tar
org.skife.terminal
org.skife.url
org.skife.vmware
org.skywaysoftware
org.smerty
org.smurn
org.softee
org.softus.cdi.transaction
org.soitoolkit
org.soitoolkit.commons
org.soitoolkit.refapps.dealernetwork
org.soitoolkit.refapps.sd
org.soitoolkit.tools
org.soitoolkit.tools.encryption.web
org.solovyev.external.com.electriccloud
org.sonatype.book
org.sonatype.buildsupport
org.sonatype.forge
org.sonatype.hudson
org.sonatype.micromailer
org.sonatype.nexus.archetypes
org.sonatype.nexus.plugins.kenai
org.sonatype.nexus.xstream
org.sonatype.plexus.archiver
org.sonatype.runtime.recipes.bars
org.sonatype.security.realms.ldap
org.sonatype.tycho.extras
org.sorm-framework
org.sourceforge.xradar
org.spark-project.protobuf
org.spdx
org.spiffyui.maven.plugins
org.springframework.build
org.springframework.build.aws
org.springframework.data.build
org.springframework.data.gemfire
org.springframework.javaconfig
org.springframework.maven.skins
org.springframework.mobile
org.springframework.roo
org.springframework.shell
org.springjutsu
org.springunit
org.sqins
org.sql2o
org.squarebrackets
org.squartz
org.squirrelframework
org.sterlingcode
org.stripesstuff
org.subtlelib
org.swframework
org.swift.common
org.swift.fisheye.cli
org.switchyard.archetypes
org.synyx
org.synyx.synrp-api
org.syslog4j
org.tachyonproject
org.talend.camel
org.talend.esb.locator.service.rest
org.talend.esb.sts
org.tango-project
org.tashlin
org.tautua.maven.skins
org.tbag
org.templateit
org.terracotta.agent
org.terracotta.ehcachedx
org.terracotta.internal
org.terracotta.license
org.terracotta.maven.skins
org.terracotta.plugin
org.terracotta.quartz
org.testaco
org.testfun
org.testinfected
org.testinfected.time
org.theblackproject
org.threadly
org.tickcode
org.tigris.antelope
org.tigris.jsapar
org.timothyb89
org.tindalos.principle
org.tinyjee.dim
org.tinyjee.jgraphx
org.tmate
org.tnmx
org.tomdz.maven
org.tomfolga
org.tomitribe
org.toomuchcode
org.torpedoquery
org.toxos.activiti
org.trendafilov.confucius
org.trpr
org.truffulatree
org.turbogwt.core
org.turbogwt.ext
org.turbogwt.mvp
org.turbogwt.net
org.turbogwt.tools
org.twdata.maven.trap
org.twdata.pkgscanner
org.twiliofaces
org.twinkql
org.ubercraft.statsd
org.ubercraft.sucre
org.ucmtwine
org.uddi4j
org.ukiuni.callOtherJenkins
org.umlgraph
org.unbescape
org.unitils.compositetest
org.unitils.ftp
org.unitils.jodatime
org.unitils.mail
org.unitils.objectvalidation
org.unitils.selenium
org.unitils.soapui
org.unitils.spring.batch
org.unitils.testlink
org.unitime
org.urish.gwt-titanium
org.urish.openal
org.usergrid.beanstalk
org.utgenome
org.utgenome.thirdparty
org.valid4j
org.vertx-test
org.vesalainen.bcc
org.vesalainen.dsql
org.vesalainen.gpx
org.vesalainen.kml
org.vesalainen.rss
org.vngx
org.votesmart
org.w007.activemq
org.w3c
org.webcastellum
org.wetator
org.whispercomm.c2dm4j
org.wickedsource
org.wickettools.extjs
org.wikimedia.elasticsearch.swift
org.wildfly.plugins
org.wintersleep.graphviz
org.wixtoolset
org.wololo
org.wuokko.robot
org.wymiwyg.js
org.wymiwyg.karaf.tooling
org.xanot
org.xBaseJ
org.xerial.example
org.xerial.silk
org.xflatdb
org.xmlbeam
org.xmlpull
org.xowl.hime
org.xparse
org.xpl4java
org.xqdoc
org.xume.easybuilders
org.xwiki.contrib.workflow-publication
org.xwiki.platform.tools
org.yagnus
org.yardstickframework
org.yestech.maven
org.zapodot
org.zcore.maven
org.zkoss.calendar
org.zkoss.maven
org.zkoss.zest
org.zkoss.zkforge.el
oscube
p2psockets
paddleguru
pandect
parse-ez
patterntesting
payload
penguin
ph.samson.flickr4java
ph.samson.logback
ph.samson.ws
pitt.search
pl.ais.maven
pl.allegro
pl.chalapuk.muice
pl.clareo.coroutines.core
pl.kotcrab.vis
pl.mg6.hrisey
pl.pkk82.file-hierarchy-generator
pl.pragmatists.tumbler
pl.project13
pl.project13.maven
playnice
plugboard
pluto-container
pnuts
poolman
profiler
propertea
protobuf
psidev.psi.mi
pt.lighthouselabs.obd
pt.lighthouselabs.sherlock
pulley
pump
puny
purnam
pw.hysteria
pw.hysteria.input
pygdown
quiddity
rabbitmq-client
ragtime
rave
reagi
redhill
redmine
reportrunner
riemann-clojure-client
ring-canonical-domain
ring-persistent-cookies
ring-ratelimit
ring-server
ring-wicked-pdf
ring-zombie
ritz
ro.fortsoft.gogo
ro.fortsoft.pf4j
ro.fortsoft.wicket.dashboard
ro.fortsoft.wicket.jade
ro.fortsoft.wicket.pivot
ro.fortsoft.wicket.plugin
ro.josekibold
roboguice
robot-remote-server
robust-txt
rodnaph
roller
routes-clj
rs.fon.kvizic
rss4j
rsslibj
ru.concerteza.util
ru.dimgel
ru.frostman.dropbox
ru.greatbit
ru.greatbit.utils
ru.hh.oauth.subscribe
ru.itbasis.utils
ru.lanwen.verbalregex
ru.megadevelopers
ru.perm.kefir
ru.systemate
ru.toolkas
ru.trylogic.groovy.inline
ru.trylogic.groovy.macro
ru.trylogic.maven
ru.trylogic.maven.plugins
ru.xajile.fuchakubutsu4j
ru.yaal.project.hhapi
ru.yandex
ru.yandex.android.tools
ru.yandex.qatools
ru.yandex.qatools.properties
rubydoc
sandbar
scraping-engine
se.dannej
se.fearless
se.fnord
se.gustavkarlsson
se.javasoft.maven
se.jbee
se.jguru.nazgul.core.algorithms.api
se.jguru.nazgul.core.algorithms.event.api
se.jguru.nazgul.core.algorithms.launcher.api
se.jguru.nazgul.core.algorithms.tree.api
se.jguru.nazgul.core.cache.api
se.jguru.nazgul.core.cache.example
se.jguru.nazgul.core.cache.impl.ehcache
se.jguru.nazgul.core.cache.impl.hazelcast
se.jguru.nazgul.core.cache.impl.inmemory
se.jguru.nazgul.core.clustering.api
se.jguru.nazgul.core.osgi.launcher.api
se.jguru.nazgul.core.osgi.launcher.impl.felix
se.jguru.nazgul.core.parser.api
se.jguru.nazgul.core.persistence.api
se.jguru.nazgul.core.quickstart.analyzer.api
se.jguru.nazgul.core.quickstart.analyzer.impl.nazgul
se.jguru.nazgul.core.reflection.api
se.jguru.nazgul.core.resource.api
se.jguru.nazgul.core.resource.impl.resourcebundle
se.jguru.nazgul.core.xmlbinding.api
se.jguru.nazgul.test.blueprint
se.jguru.nazgul.test.bundles.hello.client.blueprint
se.jguru.nazgul.test.bundles.hello.impl.blueprint
se.jguru.nazgul.test.bundles.hello.impl.plain
se.jguru.nazgul.test.messaging
se.jguru.nazgul.test.osgi
se.jguru.nazgul.test.persistence
se.jguru.nazgul.tools.codestyle
se.jguru.nazgul.tools.validation.api
se.jguru.nazgul.tools.validation.aspect
se.jiderhamn.classloader-leak-prevention
se.kb
se.natusoft.tools.fileeditor
se.natusoft.tools.optionsmgr
se.sawano.akka.japi
se.scalablesolutions.akka
se.skltp.aggregatingservices.clinicalprocess.healthcond.description
se.skltp.aggregatingservices.crm.requeststatus
se.skltp.components
se.softstuff.nb
se.soy.gpg
se.soy.securerstring
se.tada
se.transmode.gradle
se.ugli
se.ugli.habanero
se.unlogic
se.vgregion.alfresco-client
se.vgregion.icc.sd.authorization
se.vgregion.icc.sd.delegation
se.vgregion.javg
se.vgregion.javg.maven.archetypes
se.vgregion.javg.maven.plugins
se.vgregion.liferay-user-associations
se.weightpoint.datanucleus
seaquell
selmer-java
serializable-fn
sfx4j
shoreleave
sillyexceptions
simple-jms
sk.lukasvasek
sk.openhouse
skaringa
skinlf
sligeom
slim
soimp
solarisrealm
spectator
sqlingvo
stapler
stereotype
stratum
strucjure
struts-menu
stxx
subpersistence
subshell
suiterunner
sun-xacml
sundry
supernal
surd
tagalog
tagishauth
tclib
technology.integration.amazonservices.mws
testingbot
textarea
the
tiffrenderer
tikkba
tjdo
tk.skuro.alfresco
tk.skuro.spring.surf.clojure
tnrglobal
to.sparks
tokyocabinet
tonic
traer.physics
trail-taglib
trevorbernard
tron
tv.bodil
tw.cheyingwu
tw.edu.sju.ee.eea.commons
tw.kewang
twitter-api
ua.in.dej
ua.mobius.media.controls
ua.mobius.media.hardware
ua.pp.fland.web
ua.t3hnar.io
uaihebert.com
ubique
uk.ac.bolton
uk.ac.ceh
uk.ac.ebi.brain
uk.ac.ebi.fg.annotare2
uk.ac.ebi.intact.core
uk.ac.ebi.intact.dataexchange.psimi
uk.ac.ebi.intact.service.commons
uk.bl.wa.bitwiser
uk.bl.wa.memento
uk.bl.wa.sentimentalj
uk.bl.wa.whois
uk.co.a1dutch.zipper
uk.co.androidalliance
uk.co.binarytemple
uk.co.boundedbuffer
uk.co.chrisjenx
uk.co.chrisjenx.calligraphy
uk.co.coen
uk.co.crystalmark
uk.co.flamingpenguin.jewelcli
uk.co.gcwilliams
uk.co.grahamcox.spring-cli
uk.co.iankent
uk.co.innoltd
uk.co.jemos.testing.bedede
uk.co.matbooth
uk.co.panaxiom
uk.co.real-logic
uk.co.ribot
uk.co.shastra.hydra
uk.co.sltodd
uk.co.smr
uk.co.techblue
uk.co.thebadgerset
uk.co.visalia.brightpearl
uk.me.m0rjc
uk.me.mjt
uk.me.tom-fitzhenry.findbugs-guice
uk.org.adamretter.maven
uk.org.adamretter.shadoop
uk.org.potes.java8
uk.org.retep.doclet
uk.org.retep.site
uk.org.retep.templateEngine
uk.org.retep.third-party.docbkx-tools
uk.org.retep.xmpp.server
uk.org.retep.xmpp.test
uk.org.retep.xmpp.xmpp
unfix
us.bpsm
us.monoid.web
us.rothmichaels
user-input
vmfest
vu.nl.iref
waltz
webmacro
webtest
werkflow
werkz
which
wrapper
ws-commons-java5
ws-scout
ws.albors
ws.ament.hammock
ws.antonov.config
ws.antonov.gradle.plugins
ws.securesocial
wstx
xercesjarv
xfire-root
xmlmind
xmlrpc-helma
xmlwise
xsdlib
xtiff-jai
xwork
xxl
yij
za.co.clock24
za.co.no9
zyzanie
 
 
如对本页内容质量不满意,请直接填写反馈; 如想提出意见、建议,请到站务交流区赣ICP备13003755